PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S05662.40
Common NameJCGZ_23474, LOC105647668
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family CPP
Protein Properties Length: 766aa    MW: 83733.6 Da    PI: 6.2431
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S05662.40genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR491.2e-15448487241
            TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                    ++k+CnCk+skClk+YCeCfaag +C e C+C+dC+Nk  
  Jcr4S05662.40 448 SCKRCNCKRSKCLKLYCECFAAGLYCIEPCSCQDCFNKPA 487
                    689**********************************975 PP

2TCR53.16.4e-17563602140
            TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                    ++k+gCnCkks+ClkkYCeCf+ g+ Cs++C+Ce+CkN+ 
  Jcr4S05662.40 563 RHKRGCNCKKSSCLKKYCECFQGGVGCSSNCRCEGCKNTF 602
                    589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011147.1E-18447488IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.186448603IPR005172CRC domain
PfamPF036383.3E-11450485IPR005172CRC domain
SMARTSM011141.4E-17563604IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.9E-12565601IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 766 aa     Download sequence    Send to blast
MELNTPNKDQ LVSAPLSQFE DSPVFNYINN LSPIDLVKSV STDQTFNSLS FSSPPLVFTS  60
PKLNPQRNAR SIIRRRQFSD PLKPELSHIK GDNNASEGVS EAVELPDSCT EQLRCATSSS  120
SAKEVTTDPL NEQLELGIEL PKAFKCVGAG PDGDIALLDA IRTDIEPEKV DKSNERHCLY  180
ESEKHLRRIC RIEQSEDEAG CDWDTLISDV SDILCFDSSI SAEQSEEQKI VDPGTISFVS  240
NVLQIPQDNT NASENMESTN CVGSSEHKMG EIGTQSTELG KKEADKIPAV LSGTLLNKLV  300
VDDAATVMDI KGKKRLSSCK QNRIRRLVFE MAGAHKKKSV CESNVSPQIS PQPDSGVAQV  360
ETHSAARMSM LSRKGIGLHL NALTTTSSDC KIVKIETLSS RQEISLALCD SEDKAMENAQ  420
QTSTDVSEDF GTSSPKTKRH KLEPVGASCK RCNCKRSKCL KLYCECFAAG LYCIEPCSCQ  480
DCFNKPAHEG TVLETRKQIE SRNPLAFAPK VIRSTDFVPE IGLTWSHLCG KVPMMQSHCI  540
LLFLLGHGLF CVDEVNKTPA SARHKRGCNC KKSSCLKKYC ECFQGGVGCS SNCRCEGCKN  600
TFGTKNGLEE DEFEGGESEI LEKNALDVNL DGKIEGGEEQ HANLPELSES ARSSIKLPMT  660
FSGKLSRSLP VIGTSTQLCS SQNPGTDLFC QPKFETHLQA IPEEETPEIL TSNRSAASVV  720
KSTSPNCKRV SPPHHGFGSS ANWRGGRKLI LRSVPPFPSL NSPHQQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012089232.10.0protein tesmin/TSO1-like CXC 3
TrEMBLA0A067JI620.0A0A067JI62_JATCU; Uncharacterized protein
STRINGcassava4.1_024923m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26193375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.12e-93Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]