PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S05652.50
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family LBD
Protein Properties Length: 115aa    MW: 12986 Da    PI: 9.0086
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S05652.50genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601315e-4151041100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +CaaCk+lrr+C+ dC+++pyfp+++p++fa+vhk++Gasnv k+l+++p++ r  a++sl+yeA+ r++dPvyG+vg+i+ l+qq++ ++++la+
  Jcr4S05652.50   5 RCAACKYLRRRCSLDCIFSPYFPSNNPQRFAYVHKIYGASNVAKILQQVPDHLRASAAESLYYEAKYRIEDPVYGCVGIISLLHQQIHIAENQLAK 100
                    6*********************************************************************************************** PP

         DUF260  97 lkee 100
                    +k+e
  Jcr4S05652.50 101 TKAE 104
                    9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.5944105IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-405102IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 115 aa     Download sequence    Send to blast
MSCGRCAACK YLRRRCSLDC IFSPYFPSNN PQRFAYVHKI YGASNVAKIL QQVPDHLRAS  60
AAESLYYEAK YRIEDPVYGC VGIISLLHQQ IHIAENQLAK TKAEIAVLAS QNFTK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-38610512111LOB family transfactor Ramosa2.1
5ly0_B4e-38610512111LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012087781.13e-81LOB domain-containing protein 24-like
SwissprotP594688e-52LBD24_ARATH; LOB domain-containing protein 24
TrEMBLB9SXJ81e-61B9SXJ8_RICCO; LOB domain-containing protein, putative
STRINGXP_002530717.12e-62(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36973066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.13e-54LOB domain-containing protein 24