PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S04808.40
Common NameJCGZ_12590, LOC105639896
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family HD-ZIP
Protein Properties Length: 290aa    MW: 32297.5 Da    PI: 8.5623
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S04808.40genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.51.1e-18144198256
                    T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                    rk+ ++tkeq   Lee F+++++++ ++++ LA++l+L  rqV vWFqNrRa+ k
  Jcr4S04808.40 144 RKKLRLTKEQSALLEESFKQHSTLNPKQKQALARQLNLRPRQVEVWFQNRRARTK 198
                    788899***********************************************98 PP

2HD-ZIP_I/II125.23e-40144233191
    HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                    +kk+rl+keq++lLEesF+++++L+p++K++lar+L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l++en+rL+ke +eL+ +l
  Jcr4S04808.40 144 RKKLRLTKEQSALLEESFKQHSTLNPKQKQALARQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCETLTDENRRLQKELQELK-AL 233
                    69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.51E-19132201IPR009057Homeodomain-like
PROSITE profilePS5007117.75140200IPR001356Homeobox domain
SMARTSM003897.3E-16142204IPR001356Homeobox domain
PfamPF000464.2E-16144198IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.1E-17144198IPR009057Homeodomain-like
CDDcd000863.64E-17144201No hitNo description
PROSITE patternPS000270175198IPR017970Homeobox, conserved site
SMARTSM003405.7E-26200243IPR003106Leucine zipper, homeobox-associated
PfamPF021835.6E-10200234IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009735Biological Processresponse to cytokinin
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MGCFDDGCNT GLVLGLGFTS PKPEDKQINS NNIHKPKVIK PNCTLSNGFE PSLSLGLCGG  60
DAYRSNSKTL DVKKSFDHQE SSIVVGVVGA ELFSQASPHN SHSAVSSFSS GRVKRERDLS  120
SEEIEVERVS SRVSDEDEDG TNTRKKLRLT KEQSALLEES FKQHSTLNPK QKQALARQLN  180
LRPRQVEVWF QNRRARTKLK QTEVDCEFLK KCCETLTDEN RRLQKELQEL KALKLAQPFY  240
MHMPAATLTM CPSCERIGGV GSDSATKNNP FSMAPKPHFY NPFTNPSAAC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1142148TRKKLRL
2192200RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00477DAPTransfer from AT4G37790Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012079472.10.0homeobox-leucine zipper protein HAT22
SwissprotP466041e-100HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLA0A067KJY10.0A0A067KJY1_JATCU; Uncharacterized protein
STRINGcassava4.1_013954m1e-152(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.17e-83HD-ZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]
  3. Liu T,Longhurst AD,Talavera-Rauh F,Hokin SA,Barton MK
    The Arabidopsis transcription factor ABIG1 relays ABA signaled growth inhibition and drought induced senescence.
    Elife, 2017.
    [PMID:27697148]
  4. Song L, et al.
    A transcription factor hierarchy defines an environmental stress response network.
    Science, 2017.
    [PMID:27811239]