PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S04546.40
Common NameJCGZ_08742, LOC105635797
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family NF-YA
Protein Properties Length: 295aa    MW: 32285.4 Da    PI: 10.5041
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S04546.40genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA86.54e-27140196158
      CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                    d p++VN+KQy++I++RR +Rak+  e+k  +++rkp++h SRh hA+rRpRg+gGrF
  Jcr4S04546.40 140 DGPIFVNPKQYHGIIRRRRTRAKAVLENKS-TRKRKPFMHLSRHLHAMRRPRGNGGRF 196
                    57***************************9.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.0E-29138199IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115232.178139199IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.9E-19142164IPR001289Nuclear transcription factor Y subunit A
PfamPF020454.1E-24142196IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.9E-19173196IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MAVKTLFFKE NDGIVHNPIG QLSSVPSIPW WSNLGPQSAY GESFGSFKLS SMEQSIGGDQ  60
VTAMKQARRG TEQGLDIDKG NTTQFTMFSG DCKTSNGGQK SPQTAMSLQK ALPEHCTHID  120
LGFSPSMGRI MLPMNMTTDD GPIFVNPKQY HGIIRRRRTR AKAVLENKST RKRKPFMHLS  180
RHLHAMRRPR GNGGRFLNTK NSNGTVEIEA KNAGGVQLSQ PAGSQSSEVL QSDSSKDHGG  240
SNLSGAEVTS MYSRRNFDHF SINHLAPPLH SFSVIMDTGH NVVMPNKWDI GAAAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A5e-14142203465NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1155173RRRTRAKAVLENKSTRKRK
2155174RRRTRAKAVLENKSTRKRKP
3156174RRTRAKAVLENKSTRKRKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012074293.10.0nuclear transcription factor Y subunit A-10
TrEMBLA0A067KM650.0A0A067KM65_JATCU; Uncharacterized protein
STRINGcassava4.1_011620m1e-138(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37943464
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05690.13e-42nuclear factor Y, subunit A2
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]