PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S02590.80
Common NameJCGZ_20720, LOC105645923
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family GRF
Protein Properties Length: 204aa    MW: 22291.3 Da    PI: 9.0596
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S02590.80genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC82.24.6e-26135179145
            WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                    d+epgrCrRtDGKkWRCs+++l+++k+CErH+hrgr+rsrk +e+
  Jcr4S02590.80 135 DPEPGRCRRTDGKKWRCSKEALPDQKYCERHMHRGRQRSRKLVEA 179
                    79***************************************9985 PP

2QLQ38.34.1e-1468102337
            QLQ   3 FTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                    FT  Qlq+L  Q l+yKy+ a+ PvP +L+++i+k
  Jcr4S02590.80  68 FTILQLQELQLQSLIYKYIEAGFPVPYNLVLPIWK 102
                    7888******************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009510.002366102IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166618.11767102IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.1E-1068101IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.77135179IPR014977WRC domain
PfamPF088794.9E-22136178IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
METQAPPSKI ARLADSSIVQ ASCLSMERNG SSGGPGSPTV CLGLALGHGS GSTDNRTIPA  60
LSTAPNGFTI LQLQELQLQS LIYKYIEAGF PVPYNLVLPI WKSVSSPLNS SLHQLYPTLM  120
VGSSQMQWEC RNGMDPEPGR CRRTDGKKWR CSKEALPDQK YCERHMHRGR QRSRKLVEAA  180
SQTNTSNSNT STNLSISLPL STEL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012087056.11e-150PREDICTED: growth-regulating factor 10-like
SwissprotQ6EPP94e-43GRF10_ORYSJ; Growth-regulating factor 10
TrEMBLA0A067K1941e-150A0A067K194_JATCU; Uncharacterized protein
STRINGPOPTR_0001s08310.16e-75(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF141951017
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.12e-29growth-regulating factor 2
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]