PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S02435.50
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family CPP
Protein Properties Length: 416aa    MW: 46031.1 Da    PI: 6.4121
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S02435.50genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR49.96.2e-16110148240
            TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                    e+kgC+Ckks+C+kkYCeCf+a+  Cse+CkC +CkN e
  Jcr4S02435.50 110 EQKGCHCKKSNCIKKYCECFQANIRCSENCKCVKCKNLE 148
                    68***********************************76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011140.151466IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163423.53915149IPR005172CRC domain
SMARTSM011141.3E-16109150IPR033467Tesmin/TSO1-like CXC domain
PfamPF036385.1E-12111147IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 416 aa     Download sequence    Send to blast
MPRLRARIIS GAPMIRRRCH CKQSKCIQLC PEVVASAYEN GTVNALLLEH SCDGCGCSAC  60
HNNIENEAIR KSTIESILKR TGKAFKPKIA SSSQTDGDNA KTVPIMLVGE QKGCHCKKSN  120
CIKKYCECFQ ANIRCSENCK CVKCKNLEVN EQRTAHSWGE YDNSKASVEE TNAATFAAIG  180
SSGYSFSQET RKRKYQEILD SDKKEQEIQD IKQDQQENPV TVSGSFPTFS VTPAHCILSS  240
TVLGSSKFAY RSLLADVVQP LDTRELCSFL VVASKAAKIL PDMQEAKENQ IATIPADQNG  300
KNQEKEPDDQ KVTSDNNLST GNQTDTLDVE VSRSDGTNVQ EGRLFLSQRD ELMCDEEEIL  360
FHGPASPEEI LNHGFTADFY GEMERLALTC LHDCLAKLIT FGGVKGKVFR LIMNVI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-146415347127Protein lin-54 homolog
5fd3_B2e-146415347127Protein lin-54 homolog
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020535326.10.0protein tesmin/TSO1-like CXC 6 isoform X3
RefseqXP_020535327.10.0protein tesmin/TSO1-like CXC 6 isoform X3
TrEMBLA0A067KMD50.0A0A067KMD5_JATCU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2255944
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-74Tesmin/TSO1-like CXC domain-containing protein