PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S02320.20
Common NameJCGZ_17350, LOC105639196
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family LBD
Protein Properties Length: 171aa    MW: 19012.5 Da    PI: 6.6538
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S02320.20genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.81.8e-4381071100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +Ca+Ck+lrr+CakdC++apyfp+++p+kfa+vhk+FGasnv+k+l+++p ++r da+sslvyeA arardPvyG+vg i+ lq+q+++l+ +l++
  Jcr4S02320.20   8 PCASCKLLRRRCAKDCIFAPYFPSHDPHKFAIVHKVFGASNVSKMLQEIPVDQRADAVSSLVYEASARARDPVYGCVGAISYLQNQVSELQMQLSV 103
                    7**********************************************************************************************9 PP

         DUF260  97 lkee 100
                    +++e
  Jcr4S02320.20 104 AQAE 107
                    9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.6067108IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-438105IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MAGSSSPPCA SCKLLRRRCA KDCIFAPYFP SHDPHKFAIV HKVFGASNVS KMLQEIPVDQ  60
RADAVSSLVY EASARARDPV YGCVGAISYL QNQVSELQMQ LSVAQAELFC IQMQQQEPVI  120
FPNQDQDHEV KSSLDLATNN SSGNQIPHYY NFTSSSNVTI QDPLKRESLW T
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012078565.11e-126PREDICTED: LOB domain-containing protein 12
SwissprotQ8LBW33e-73LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A067LEW41e-126A0A067LEW4_JATCU; Uncharacterized protein
STRINGVIT_06s0004g07200.t012e-87(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.12e-74LBD family protein
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]