PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S02010.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family GeBP
Protein Properties Length: 111aa    MW: 13354.2 Da    PI: 5.6572
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S02010.10genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57379.36.1e-254881297
         DUF573 12 eivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97
                   ei++L+G+idf+++tg  + d+++af ef+k+ +++kv ++ql +Ki rLKkK+k+++++ ++g+  +f k+h++k+f ls  iWg
  Jcr4S02010.10  4 EITVLKGMIDFHETTGNYACDNVTAFLEFIKDFLHVKVCQKQLYDKIWRLKKKYKNNKERLEDGQTLDFLKSHEEKMFMLS-LIWG 88
                   9*****************************************************************************997.6887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.2E-20488IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 111 aa     Download sequence    Send to blast
NPTEITVLKG MIDFHETTGN YACDNVTAFL EFIKDFLHVK VCQKQLYDKI WRLKKKYKNN  60
KERLEDGQTL DFLKSHEEKM FMLSLIWGSE NKEKKEGEED EFWSMYPHLN E
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022930845.18e-20STOREKEEPER protein-like
RefseqXP_023531444.17e-20STOREKEEPER protein-like
TrEMBLA0A0A0K1N45e-18A0A0A0K1N4_CUCSA; Uncharacterized protein
STRINGXP_004174048.12e-19(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18313490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00390.15e-14DNA-binding storekeeper protein-related transcriptional regulator