PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S01758.60
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family SBP
Protein Properties Length: 345aa    MW: 38298.4 Da    PI: 8.5004
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S01758.60genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP40.57.4e-13148184238
                    -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTE CS
            SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgl 38 
                    CqvegC++ l +ak+yhrrhkvCe+hskap++  s  
  Jcr4S01758.60 148 CQVEGCHVVLVNAKDYHRRHKVCEMHSKAPKCRSSTN 184
                    ******************************9987654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.9E-13143180IPR004333Transcription factor, SBP-box
PROSITE profilePS5114110.349145178IPR004333Transcription factor, SBP-box
SuperFamilySSF1036129.94E-12146180IPR004333Transcription factor, SBP-box
PfamPF031105.4E-8148181IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MAVTCTVLTT TVTEASKMHH RHCCCHDNPL LGKVPTLRTQ KPLLTHALVL PNENLYLHHY  60
HHHEDHYQQH SLYGGEGSNL HPDPHLMCLK LGKRHYFEDN IAVGERQVAS LCIGKKKKSY  120
YSVVDGGTVR PLSSAAGEVV AAAAVPKCQV EGCHVVLVNA KDYHRRHKVC EMHSKAPKCR  180
SSTNQRGAVG GDWQVTMREE ERVLTILFPG TLAQKRLIWS STEKLMARRI PCLASTTGRA  240
LSLLSSKEDS WVSSSDLSSR SSAALRGRHQ SSQASSNSCF VPHQHQILAE SQNWGRFHDS  300
GTQLTLDLMQ APSSAFGFLP TRAKNTKDEE ESCAELWDTW AGAHI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012083645.11e-145squamosa promoter-binding-like protein 7
TrEMBLA0A067K9661e-144A0A067K966_JATCU; Uncharacterized protein
STRINGcassava4.1_008947m3e-97(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96132738
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.39e-12squamosa promoter binding protein-like 2