PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S01404.30
Common NameGRAS09, JCGZ_12517, LOC105639828
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family GRAS
Protein Properties Length: 458aa    MW: 51371.9 Da    PI: 5.9692
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S01404.30genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS305.99.4e-94494552373
           GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn....sseelaalkl..fsevsPil 91 
                    ++lL++cA+a++s+d++laq++L+ l+++asp+gd++qRl+  f++AL ar a+  s+++k l++ ++++ n     ++++++ +l  f++++P++
  Jcr4S01404.30  49 EQLLVHCANAIQSNDATLAQQILWVLNNIASPEGDSNQRLTCAFLKALIARAAK--SGTCKLLAAMANAHCNnlsiNTHKFSVIELagFVDLTPWH 142
                    79****************************************************..66666664444433333445555555556689******** PP

           GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg......skeeleetgerLakfAeelgvpfefnvl 181
                    +f++ +aN aIlea+eg + vHi+D+++++++Q p+L++a++sR e +p +++T+v++ +++         +++e+g++L +fA++ +v +ef+v+
  Jcr4S01404.30 143 RFGFTAANAAILEAIEGFSVVHIVDLSLTHCMQIPTLIDAISSRFEVTPLIKLTVVSPIDEDiifppmLDLSYQELGSKLINFARSRNVILEFRVV 238
                    **********************************************************99999**98888999**********************9 PP

           GRAS 182 ...vakrledleleeLrvkp........gEalaVnlvlqlhrll.................desvsleserdevLklvkslsPkvvvvveqeadhn 249
                       +++ +++l +e+Lrv +        +Eal++n+++ lh+++                  +s+s +s r+ +Lk ++sl P++vv+v+++ad++
  Jcr4S01404.30 239 pssYSDGFSTL-IEQLRVMQnlvyaesyNEALVINCHMLLHYIPeetlssgiimnnsniypFDSTSASSFRTMFLKSLRSLDPTIVVLVDEDADLT 333
                    87767777777.99999999999999***********************************778888888************************** PP

           GRAS 250 sesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk 345
                    s++++ r+ +a++y +  +d++++ lpr s++r+++E+  + ++i+nv+a eg +r+er e ++kW +r+++a F++v+++e+a++++k++l++++
  Jcr4S01404.30 334 SNNLVCRLRSAFNYLWIPYDTVDTFLPRGSKQRQWYEAD-ICWKIENVIAYEGLRRVERIEPKNKWVQRMRNANFTSVSFGEDAVSEVKTMLAEHA 428
                    ***************************************.******************************************************** PP

           GRAS 346 sdgyrveeesgslvlgWkdrpLvsvSaW 373
                      g+ +++e++ lvl+Wk++++v+++aW
  Jcr4S01404.30 429 -AGWGLKKEEEDLVLTWKGHNVVFATAW 455
                    .899************************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098542.52322437IPR005202Transcription factor GRAS
PfamPF035143.2E-9149455IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    Send to blast
MMQFTETPPP PLHQISTMNK NQTQRARPWP AGFPSSKSLS SLGDANCMEQ LLVHCANAIQ  60
SNDATLAQQI LWVLNNIASP EGDSNQRLTC AFLKALIARA AKSGTCKLLA AMANAHCNNL  120
SINTHKFSVI ELAGFVDLTP WHRFGFTAAN AAILEAIEGF SVVHIVDLSL THCMQIPTLI  180
DAISSRFEVT PLIKLTVVSP IDEDIIFPPM LDLSYQELGS KLINFARSRN VILEFRVVPS  240
SYSDGFSTLI EQLRVMQNLV YAESYNEALV INCHMLLHYI PEETLSSGII MNNSNIYPFD  300
STSASSFRTM FLKSLRSLDP TIVVLVDEDA DLTSNNLVCR LRSAFNYLWI PYDTVDTFLP  360
RGSKQRQWYE ADICWKIENV IAYEGLRRVE RIEPKNKWVQ RMRNANFTSV SFGEDAVSEV  420
KTMLAEHAAG WGLKKEEEDL VLTWKGHNVV FATAWLSA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B3e-494445583472Protein SHORT-ROOT
5b3h_B9e-504445529418Protein SHORT-ROOT
5b3h_E9e-504445529418Protein SHORT-ROOT
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM4052740.0KM405274.1 Jatropha curcas GRAS09 protein (GRAS09) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012079380.10.0scarecrow-like protein 32
SwissprotQ9SN220.0SCL32_ARATH; Scarecrow-like protein 32
TrEMBLA0A067K7340.0A0A067K734_JATCU; GRAS09 protein
STRINGEOX916400.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77023347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.10.0GRAS family protein
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]