PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S01385.100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family CPP
Protein Properties Length: 1371aa    MW: 151472 Da    PI: 8.0948
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S01385.100genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR49.58.3e-16218257140
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  Jcr4S01385.100 218 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCMDCKNFE 257
                     589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5163428.925137258IPR005172CRC domain
SMARTSM011140.26144174IPR033467Tesmin/TSO1-like CXC domain
SMARTSM011148.4E-20218259IPR033467Tesmin/TSO1-like CXC domain
PfamPF036383.1E-12221256IPR005172CRC domain
Gene3DG3DSA:3.40.50.18205.6E-368021040IPR029058Alpha/Beta hydrolase fold
SuperFamilySSF534741.96E-278031040IPR029058Alpha/Beta hydrolase fold
PfamPF003263.4E-6807906IPR001375Peptidase S9, prolyl oligopeptidase, catalytic domain
PfamPF054486.3E-710731230IPR008391Acetyl xylan esterase
Gene3DG3DSA:3.40.50.18201.3E-4210981249IPR029058Alpha/Beta hydrolase fold
SuperFamilySSF534741.12E-3311071370IPR029058Alpha/Beta hydrolase fold
Gene3DG3DSA:3.40.50.18201.3E-4212851370IPR029058Alpha/Beta hydrolase fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006508Biological Processproteolysis
GO:0008236Molecular Functionserine-type peptidase activity
Sequence ? help Back to Top
Protein Sequence    Length: 1371 aa     Download sequence    Send to blast
MEQSEAISDF APKKLARQLD FTAICRASAN VILTEHSKMQ QPPPPSQSQP HLKLQPHAQQ  60
PPSNPVQSQL QSQPQPILHL QLQTPPKQPP VMPQLQARPH QTPAVRRIPH LVQKIPLSTM  120
PAPKQESPGA RPRNNVEAKE GTPKKAKQCI ASVFAAGIHC NGCNCINCYN NVENEAARQE  180
AVGATLERNP NAFRPKIASS PHGYNPREDA SEAQIVGKHN KGCHCKKSGC LKKYCECFQA  240
NILCSENCKC MDCKNFEGSE ERRALFHGNH NGITCMQQAA NAAVSGAIGS SGYETPLASK  300
KRKNEEILGS VTKDKSAKFQ QENHLRNSAS SFSPSSAPIP CAASATVFGS SRLTYKSPLT  360
DKIQPQDVAQ MCTFFLVLSE KARKALEGKM DKEKTHSVEA TTALSIEGRK DSLNGHDAHK  420
TLPDDDLNRN KATTDRSTDS GTDGCVVEDG RPASPEIDLM CHEQEMMFME VGPPTGVGRL  480
CGNKTQLSSS GHECSEVYAE QEKLILSRFR DFLNMLIFRG SAKETMYSPS AMSKMMDQQE  540
PAEEEIINSA TESGSHEKAY NNAVVKSAVI ATSASNVIQP KNIMCLYNEV TISQSPAVLD  600
ALPTFGYAKP TSKHLSMEVS LYATINCDAS SVSASAKPHE AGGLKRMLIS RLASVKVQAQ  660
IFLLPHSQRT HFSLIRPFTL DSSPLSICIA HPPKLVSYKY GNPALTKAVT EYNTPPPPPT  720
TSTAGEMEKE SIDVQKIRSE FLQVLRSRRS GEVPLSVQNG EPVMNPLYLD NTLPTDKSEA  780
MESCPKKDIK NCKDLVKEEN LYLTTEAYAS RGYVAVAIDS RYHGERAKNK TTYRDALVSS  840
WKKGDKMPFI FDTVWDLIKL ADYLTQRKDI DPKKIGITGE SLGGMHAWFA AAVDTRYSVV  900
APIIGVQGFR WAIENDKWQA RVDSVKPVFE EARIDLGKSA IDKEVVEKVW DRIAPGLASS  960
FDSPYTIPAI APRPLLILNG AEDPRCPLAG LEIPKLRADK AYGEAHSLDK FKLVAQPGIG  1020
HQMTPFMVKE ASDWFDKFLN SAIGGNWKTG GGLVVSGRYA VNREAMESCP KKEIENFKGL  1080
LKEENLYLIT EAGEQGRVPM LILSLKESNE RRPAIVFLHR TNTCKEWLRP LLEAYASRGY  1140
VAIAIDSRYH GERAKTKTTY QDALVSSWRI GDTMPFIFDT VWDLIKLADY LTQREDIDPK  1200
RIGITGESLG GMHAWFAAAA DTRYAVVVPI IGVQGFRWAI DNNRWQARVN SIRPVFEEAQ  1260
KDLGKTEIDK EVVEKASAVW DRIAPGIASK FDSPYTIPAI APRPLLILNG AKDQRCPIAG  1320
LEIPKSRACK AYEEANSLDK FEVVSESGIW HQVTPTMVNE ASDWFDKFLK Q
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A4e-2417226747132Protein lin-54 homolog
5fd3_B4e-2417226747132Protein lin-54 homolog
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0096741e-39AP009674.1 Lotus japonicus genomic DNA, chromosome 1, clone: LjT04O06, TM0487, complete sequence.
GenBankAP0150351e-39AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A067KGT00.0A0A067KGT0_JATCU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF596322
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.18e-91Tesmin/TSO1-like CXC domain-containing protein