PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S01215.30
Common NameJCGZ_07197, LOC105637673
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family CPP
Protein Properties Length: 892aa    MW: 97881.1 Da    PI: 5.8981
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S01215.30genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR48.12.2e-15471509341
            TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                    +k+CnCkk+kClk+YC+Cfaag +C++ C C++C+N+ e
  Jcr4S01215.30 471 CKRCNCKKTKCLKLYCDCFAAGMYCADPCACQGCFNRPE 509
                    79**********************************876 PP

2TCR48.91.3e-15557595139
            TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                    ++k+gCnCk+s ClkkYCeC+++++ Cs eC+Ce+CkN 
  Jcr4S01215.30 557 RHKRGCNCKRSMCLKKYCECYQENVGCSTECRCEGCKNV 595
                    589***********************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011149.6E-16469510IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163434.637470597IPR005172CRC domain
PfamPF036384.2E-11472507IPR005172CRC domain
SMARTSM011143.2E-16557598IPR033467Tesmin/TSO1-like CXC domain
PfamPF036384.9E-11559594IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 892 aa     Download sequence    Send to blast
MDSPEPAKTS DITSTVTTIA ATALSDSPSV QESPFTNYVS NLSPIKPVRA PHPVQGYVGV  60
ASPPLVFTSP RIISHRETSF LQRSQLSQIY SAETHANDDG NNKVVDHSDD HLEKSVTYCS  120
RLIADTQKDN DVENSPQDQP GSSSGFVDEF LRDPVDADCA NSQNLVNSNA EQSNDVLQSS  180
VSSSSNSNAV KLKSDDKNYM SLCVHMSQAS HEQVEEDPQG QSTLEIKPIQ VEEVQSSIKQ  240
PSNKFPNIES DLPSDNAPEQ YDDSEIQMVQ ACELYSENLE ATLQGDIQNV AKCDSEASQL  300
QRGFSRRCLQ FEEAQKKIIV NSTSSPNLTK NVTSSGSPAS AADLESLDPS HVGITESSQK  360
KQMINLSRTM TSMFPLRRSG KSPIVASKPS GIGLHLNSIV NALPMGHTAT ASMKSTPIMS  420
FHQVDYNNSS LKLIAPEDRM LEIKASPVVE PLNMLQPLEH QKASSIDGDG CKRCNCKKTK  480
CLKLYCDCFA AGMYCADPCA CQGCFNRPEY EDTVLETRQQ IESRNPLAFA PKVVEHATEA  540
AAVSREDGSR SMSSLARHKR GCNCKRSMCL KKYCECYQEN VGCSTECRCE GCKNVYGRKE  600
EYGMTEEMVS NRVSEERLEG RVDDKLGMVA TNKDLLHAES YDLHNLTPST PSFQHSDHGK  660
DAPKSRLNSS RYAPSPESEI SVLTSHAKSL SSPSNSQHNM IPKRSKEIQE VDSCSQDMDY  720
NIAEMMDQFS PRCNTLADIC DLTPLQNTLT SIASSASSKP RDWSSSSRLQ LCPGSGRLSS  780
GRSLRWRSSP ITPMTRLGEN KNLGHDSDSG LYDILEDDTP EILKEASIPI PSVKASSPNK  840
KRISPPYKRI HDLRSSTSAG LRSGRKFILK AVPSFPPLTP CTDSKDSTNE KQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-1747459514121Protein lin-54 homolog
5fd3_B2e-1747459514121Protein lin-54 homolog
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012076620.10.0CRC domain-containing protein TSO1 isoform X1
TrEMBLA0A067KBM50.0A0A067KBM5_JATCU; Uncharacterized protein
STRINGcassava4.1_029190m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85652841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.14e-61TESMIN/TSO1-like CXC 2
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]