PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S01139.30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family HD-ZIP
Protein Properties Length: 909aa    MW: 99922.6 Da    PI: 6.5478
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S01139.30genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.24.5e-21116171156
                    TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                    +++ +++t++q++eLe+lF+++++p++++r eL+k+l+L++rqVk+WFqNrR+++k
  Jcr4S01139.30 116 KKRYHRHTPQQIQELEALFKECPHPDEKQRLELSKRLSLETRQVKFWFQNRRTQMK 171
                    688999***********************************************999 PP

2START1457.2e-463255151172
                    HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEE CS
          START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetle 83 
                    ela++a++elvk+a+ +ep+W +s     e++n +e++++f++  +     + +ea+r++g v+ ++  lve+l+d++ +W e+++    + +t++
  Jcr4S01139.30 325 ELALAAMDELVKMAQTDEPLWIRSLeggrEILNHEEYMRTFTPCIGmkpsgFFSEASRETGTVIINSLALVETLMDSN-RWAEMFPcmiaRTTTTD 419
                    5899**************************************99989*******************************.***************** PP

                    EECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE- CS
          START  84 vissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdl 172
                    vissg      g lqlm aelq+lsplvp R++ f+R+++q+ +g+w++vdvS+d  ++ +  + ++ +++lpSg+++++++ng+sk  +v   dl
  Jcr4S01139.30 420 VISSGmggtrnGSLQLMHAELQVLSPLVPvREVNFLRFCKQHAEGVWAVVDVSIDTIRETSGAPTFINCRRLPSGCVVQDMPNGYSKPEYVLTRDL 515
                    ***********************************************************999****************************998776 PP

3START44.83.4e-15561603164206
                    EEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
          START 164 vtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                    vtwveh++++++++h+l+r+l++sg+ +ga++wvatlqrqce+
  Jcr4S01139.30 561 VTWVEHAEYEESQIHQLYRPLISSGMGFGAQRWVATLQRQCEC 603
                    8****************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.09E-2099173IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-21102167IPR009057Homeodomain-like
PROSITE profilePS5007117.605113173IPR001356Homeobox domain
SMARTSM003892.4E-19114177IPR001356Homeobox domain
CDDcd000864.53E-19115173No hitNo description
PfamPF000461.3E-18116171IPR001356Homeobox domain
PROSITE patternPS000270148171IPR017970Homeobox, conserved site
PROSITE profilePS5084838.521316606IPR002913START domain
SuperFamilySSF559615.16E-29318503No hitNo description
CDDcd088754.25E-117320602No hitNo description
PfamPF018521.8E-37325515IPR002913START domain
SMARTSM002341.9E-38325603IPR002913START domain
SuperFamilySSF559615.16E-29558603No hitNo description
PfamPF018522.0E-11561603IPR002913START domain
SuperFamilySSF559611.08E-18631726No hitNo description
SuperFamilySSF559611.08E-18768902No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 909 aa     Download sequence    Send to blast
MSFGGFLENG SPGGGGARIV ADIPYSSSNM PTGAIAQPRL VSPSLTKSMF SSPGLSLALQ  60
QPNIDSPGDM GRMAENFEPS GGRRSREEEH ESRSGSDNMD GASGDDQDAA DNPPRKKRYH  120
RHTPQQIQEL EALFKECPHP DEKQRLELSK RLSLETRQVK FWFQNRRTQM KTQLERHENS  180
LLRQENDKLR AENMSIRDAM RNPICSNCGG PAIIGDISLE EQHLRIENAR LKDELDRVCA  240
LAGKFLGRPI SSLAGSIGPP MPNSSLELGV GSNGFGGLST VATTLPLGPD FGGGISSLPV  300
MNQPRSTTTG VTGLDRSLER SMFLELALAA MDELVKMAQT DEPLWIRSLE GGREILNHEE  360
YMRTFTPCIG MKPSGFFSEA SRETGTVIIN SLALVETLMD SNRWAEMFPC MIARTTTTDV  420
ISSGMGGTRN GSLQLMHAEL QVLSPLVPVR EVNFLRFCKQ HAEGVWAVVD VSIDTIRETS  480
GAPTFINCRR LPSGCVVQDM PNGYSKPEYV LTRDLIVKLH DCAILFPYEY PNPFLNNSTH  540
LDVAFYVPRA IYEICLHFPL VTWVEHAEYE ESQIHQLYRP LISSGMGFGA QRWVATLQRQ  600
CECLAILMSS TVPSRDHTAI TASGRRSMLK LAQRMTDNFC AGVCASTVHK WNKLNAGNVD  660
EDVRVMTRKS VDDPGEPPGI VLSAATSVWL PVSPQRLFDF LRDERLRSEW DILSKRRTHA  720
GDGPHSQRPG SRQLRLAVTC QRELERTSWE FGIIQMDRHR QTVVALREIY HIILSVQAMN  780
ANQSSMLILQ ETCIDAAGSL VVYAPVDIPA MHVVMNGGDS AYVALLPSGF SIVPDGPGSR  840
GSPSTNANGP SSNNGGGQQR VSGSLLTVAF QILVNSLPTA KLTVESVETV NNLISCTVQK  900
IKAALQCES
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1714718KRRTH
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012083470.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A067JXS10.0A0A067JXS1_JATCU; Uncharacterized protein
STRINGcassava4.1_001764m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]