PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S01037.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family NF-YA
Protein Properties Length: 331aa    MW: 36305.6 Da    PI: 8.9017
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S01037.20genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA104.96.9e-33181237158
      CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                    d p+YVNaKQy++Il+RRq+Rakle+++kl  ksrkpylheSRh hAl+R RgsgGrF
  Jcr4S01037.20 181 DGPIYVNAKQYHGILRRRQSRAKLEAQNKL-VKSRKPYLHESRHLHALNRVRGSGGRF 237
                    57****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005214.7E-37179240IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.071180240IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006164.2E-24183205IPR001289Nuclear transcription factor Y subunit A
PfamPF020454.8E-28183237IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860185205IPR018362CCAAT-binding factor, conserved site
PRINTSPR006164.2E-24214237IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MAVPIQNLPE KNFGQVPFAF NCPSWWYSNE QQNPVSVSRN ISFKVKPPHQ LYREGQNLGL  60
QLPDQESSSC QSIGKSHNEV GAMGESNSQD QCISSESGQD ENCTKGVGGR MKPVFLFSTP  120
EIALNPSQVD NCYSMARAPF PHADNYFGGL FTPYGPQTIL GSQMVGMTSA RVPLPLDLAD  180
DGPIYVNAKQ YHGILRRRQS RAKLEAQNKL VKSRKPYLHE SRHLHALNRV RGSGGRFLST  240
KRSQQPDPTS TSCTHGVSDT ISFHQKNEMS EREMCVSRAG QSGASNTTRS DITSVSSSDL  300
IFRQPDRRFS GMSTHIGGGM QTSGGLICSG T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A3e-21183250474NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012077008.10.0nuclear transcription factor Y subunit A-3
RefseqXP_012077009.10.0nuclear transcription factor Y subunit A-3
RefseqXP_012077010.10.0nuclear transcription factor Y subunit A-3
RefseqXP_020536550.10.0nuclear transcription factor Y subunit A-3
RefseqXP_020536552.10.0nuclear transcription factor Y subunit A-3
RefseqXP_020536553.10.0nuclear transcription factor Y subunit A-3
TrEMBLA0A251IZS81e-180A0A251IZS8_MANES; Uncharacterized protein
STRINGcassava4.1_011576m1e-180(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF69493149
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.17e-51nuclear factor Y, subunit A3