PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00916.80
Common NameJCGZ_04001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family ARR-B
Protein Properties Length: 701aa    MW: 76848.7 Da    PI: 5.426
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00916.80genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.76.2e-29208261155
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    kpr++W+ eLH++Fv av+qL G +kA+Pk+il+lm+v+gLt+e+v+SHLQkYRl
  Jcr4S00916.80 208 KPRVVWSVELHRKFVAAVNQL-GLDKAVPKKILDLMNVEGLTRENVASHLQKYRL 261
                    79*******************.********************************8 PP

2Response_reg83.37.4e-28221301109
                    EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTE CS
   Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGa 94 
                    vl vdD+p+ +++++++l+k +y +v+++ ++  al++l+e++  +Dl++ D++mp+mdG++ll+     e++lp+i+++ah++ e++ + +  Ga
  Jcr4S00916.80  22 VLAVDDDPICLKVIENLLRKCQY-QVTTTNQAITALNMLRENRnkYDLVISDVNMPDMDGFKLLELVGL-EMDLPVIMLSAHSDRELVYKGVTHGA 115
                    799********************.***************999889*******************87754.558*********************** PP

                    SEEEESS--HHHHHH CS
   Response_reg  95 kdflsKpfdpeelvk 109
                     d+l Kp+ +eel +
  Jcr4S00916.80 116 VDYLLKPVRIEELKN 130
                    ************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.1E-1671701IPR017053Response regulator B-type, plant
SuperFamilySSF521724.55E-3719146IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23006.7E-4319153No hitNo description
SMARTSM004481.8E-3420132IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011044.22521136IPR001789Signal transduction response regulator, receiver domain
PfamPF000724.2E-2522130IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.55E-2923136No hitNo description
PROSITE profilePS5129412.169205264IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.6E-31205266IPR009057Homeodomain-like
SuperFamilySSF466896.27E-20206265IPR009057Homeodomain-like
TIGRFAMsTIGR015578.6E-25208261IPR006447Myb domain, plants
PfamPF002491.2E-7210260IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0009736Biological Processcytokinin-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 701 aa     Download sequence    Send to blast
MVVEDKRSGL VNEDKFPVGM RVLAVDDDPI CLKVIENLLR KCQYQVTTTN QAITALNMLR  60
ENRNKYDLVI SDVNMPDMDG FKLLELVGLE MDLPVIMLSA HSDRELVYKG VTHGAVDYLL  120
KPVRIEELKN IWQHVIRRKK LQTKDQNRSP NQEKPCDGAG EGGQGLSSSG SADQNGKANR  180
KRKDQDEDED EEGEENINEN EEPGSQKKPR VVWSVELHRK FVAAVNQLGL DKAVPKKILD  240
LMNVEGLTRE NVASHLQKYR LYLKRISNAA SQQANMVAAF GAKDPSYLRM GSLDGFGDFR  300
TLTGPGRLSS TSISSYPSGG MLGRLNSPAG LTLRGIASSG LLQPGHSPAL SNSVNTLGKL  360
QPALLPSSQG ANLFPGVPSS LEPNQLQGKS NAHIGDFNRN DDTSGFTLAT SFSDARVTPG  420
SLGNTVSSSI SNPLMLQVNP QQNQSRGAFA TQSTLSLPSM NQEPFDVGVQ GSSNFLDHSR  480
CNENWQGAVQ LSKFSTNPLP LSEPFSHDPL SASNLRDSIS STSSQIGNSP NVFSSSSALA  540
APLDSRVDMQ GQASLIGNVF QNMNYNSRQR WDEHSQDYHS NLNNSISNIN PLVSDNGVVG  600
TLNQSIDQRK KFDASIVGQL NNVTPSTFQH PEVEKSSLDP KMRSNEDYLL EQMKSQNSFA  660
QNNYESLDDI MNAMIKRQEQ NETMLMDGEF GFDAYSLGSC I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A4e-25205267264ARR10-B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00057PBMTransfer from AT5G58080Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF0220050.0KF022005.1 Jatropha curcas response regulator (RR) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012071466.10.0two-component response regulator ARR18 isoform X1
TrEMBLA0A067KUK40.0A0A067KUK4_JATCU; Uncharacterized protein
STRINGcassava4.1_002953m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58080.11e-122response regulator 18
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]