PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00826.20
Common NameJCGZ_05687, LOC105628358
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family WOX
Protein Properties Length: 212aa    MW: 24018.2 Da    PI: 9.5968
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00826.20genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.62.8e-201978357
                   --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
       Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                   +R+++tkeq+  Le l+++  r+p+a+++++++++l    +++ ++V++WFqN++a++++
  Jcr4S00826.20 19 SRWNPTKEQISLLEGLYRQgIRTPTADQIQQITARLkafgHIEGKNVFYWFQNHKARQRQ 78
                   7*****************99**************************************97 PP

2Wus_type_Homeobox114.65e-371780265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       +++RW+Pt+eQi +Le ly++G+rtP++++iq+ita+L+++G+ie+kNVfyWFQN+kaR+rqkq
      Jcr4S00826.20 17 VNSRWNPTKEQISLLEGLYRQGIRTPTADQIQQITARLKAFGHIEGKNVFYWFQNHKARQRQKQ 80
                       689***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.8351479IPR001356Homeobox domain
SuperFamilySSF466891.2E-121485IPR009057Homeodomain-like
SMARTSM003892.7E-41683IPR001356Homeobox domain
PfamPF000466.8E-181978IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.2E-81978IPR009057Homeodomain-like
CDDcd000866.56E-62080No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MESENIEMGN SGSGAQVNSR WNPTKEQISL LEGLYRQGIR TPTADQIQQI TARLKAFGHI  60
EGKNVFYWFQ NHKARQRQKQ KQEIMGYNNI NRYLHKPHQP MFASPCTNVV CGSYYLPPID  120
LGFCPPYSKV LLPGSFKRKP RTEKIDQKAR TYACCAGYEP VMTQEYHNKN ISGNNYVNNQ  180
ETLPLFPLQP TGVLQGKAMI TASSSSSSFF GD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012065139.11e-156WUSCHEL-related homeobox 2
TrEMBLA0A067LI261e-154A0A067LI26_JATCU; Uncharacterized protein
STRINGXP_002531361.13e-92(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82563044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.11e-49WUSCHEL related homeobox 2
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]