PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00587.150
Common NameJCGZ_15706
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family LBD
Protein Properties Length: 133aa    MW: 15016.1 Da    PI: 8.492
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00587.150genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260128.72.7e-4061051100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+C++dC+++pyfp+++p++f +vhk++Gasn  k+l+++p + r++a++sl+yeA++r++dPvyG+vg+i+ l q+++ ++++la
  Jcr4S00587.150   6 RCAACKHLRRRCPSDCIFSPYFPSNNPQRFSCVHKIYGASNTAKMLEQVPSHLRDKAADSLYYEAKCRMEDPVYGCVGTITLLYQHIHDAENQLA 100
                     6********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  Jcr4S00587.150 101 KTRAE 105
                     99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.2925106IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-396103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 133 aa     Download sequence    Send to blast
MTNSGRCAAC KHLRRRCPSD CIFSPYFPSN NPQRFSCVHK IYGASNTAKM LEQVPSHLRD  60
KAADSLYYEA KCRMEDPVYG CVGTITLLYQ HIHDAENQLA KTRAEIAVLL TTHHAQQSQA  120
TTNHISLPTQ TFF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-35710612111LOB family transfactor Ramosa2.1
5ly0_B2e-35710612111LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021649066.12e-62LOB domain-containing protein 24-like
SwissprotP594676e-51LBD23_ARATH; LOB domain-containing protein 23
SwissprotP594687e-51LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A067LB334e-96A0A067LB33_JATCU; Uncharacterized protein
STRINGcassava4.1_026224m4e-61(Manihot esculenta)
STRINGXP_002530717.13e-61(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36973066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.12e-52LOB domain-containing protein 24
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]