PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00431.60
Common NameJCGZ_11566, LOC105640476
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family LBD
Protein Properties Length: 291aa    MW: 32448 Da    PI: 5.6446
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00431.60genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260127.94.6e-40101101101
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    aCaaCk++rrkC+++C+lapyfp +qpk f+n+hklFG+sn+lk++k+l+  ++ +am+s++y+A++r r Pv+G+ g+i +l+ q++q+++el++
  Jcr4S00431.60  10 ACAACKYQRRKCSSECPLAPYFPPDQPKMFQNAHKLFGVSNILKIIKDLDAPQKAEAMRSIIYQANIRDRFPVHGCWGIICQLHFQIRQAEEELHA 105
                    7*********************************************************************************************** PP

         DUF260  97 lkeel 101
                    ++++l
  Jcr4S00431.60 106 VHAQL 110
                    *9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.0959110IPR004883Lateral organ boundaries, LOB
PfamPF031953.1E-3810107IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MTLKGGTSQA CAACKYQRRK CSSECPLAPY FPPDQPKMFQ NAHKLFGVSN ILKIIKDLDA  60
PQKAEAMRSI IYQANIRDRF PVHGCWGIIC QLHFQIRQAE EELHAVHAQL EMYRQHHQHQ  120
ISSLTDDVPS QLELGMAPPT NALSLFSHNT PQPYNTVNVL PVSQQHSYSN SSNVSYSSGY  180
LDSKDHLGNS MWVQHAYGGA TTTNNDNNNS SNSMALQSQL VASQPLAIQQ EVVQDYDEIH  240
PFFDTIDDID SKEAYNSSSE ESLKDTTESI EHVADNELKN AAACFSLTSV N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-2861137114LOB family transfactor Ramosa2.1
5ly0_B2e-2861137114LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012080183.10.0LOB domain-containing protein 27
SwissprotQ9STS68e-58LBD27_ARATH; LOB domain-containing protein 27
TrEMBLA0A067KG130.0A0A067KG13_JATCU; Uncharacterized protein
STRINGcassava4.1_033210m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44152958
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.13e-53LOB domain-containing protein 27
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]
  2. Kim MJ,Kim M,Kim J
    Combinatorial interactions between LBD10 and LBD27 are essential for male gametophyte development in Arabidopsis.
    Plant Signal Behav, 2015. 10(8): p. e1044193
    [PMID:26252070]
  3. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]