PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00336.60
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family CPP
Protein Properties Length: 148aa    MW: 16645.2 Da    PI: 8.7689
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00336.60genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR51.52e-161957341
            TCR  3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41
                   +++CnCk+skClk+YCeCfaag++C  +C+Ce+C+N+ e
  Jcr4S00336.60 19 CRRCNCKRSKCLKLYCECFAAGVYCVRSCTCENCFNRPE 57
                   789*********************************876 PP

2TCR52.87.7e-17105144140
            TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                    ++k+gCnCkkskClkkYCeC++a++ Cs+ C+Ce+C+N+ 
  Jcr4S00336.60 105 RHKRGCNCKKSKCLKKYCECYQAKVGCSSGCRCEGCNNSF 144
                    589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.4E-151758IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163434.6318145IPR005172CRC domain
PfamPF036381.7E-122055IPR005172CRC domain
SMARTSM011145.0E-16105146IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.8E-12107143IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
MVCYISRKRT KPVDDSEGCR RCNCKRSKCL KLYCECFAAG VYCVRSCTCE NCFNRPEYED  60
TVLDTRQQIQ ARNPLAFAPK VVIPGMNSPA NLLEDGNWTT PSSARHKRGC NCKKSKCLKK  120
YCECYQAKVG CSSGCRCEGC NNSFGKKT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A4e-192214214120Protein lin-54 homolog
5fd3_B4e-192214214120Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0119752e-98AP011975.1 Jatropha curcas DNA, clone: JHL25H03, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020535281.11e-100protein tesmin/TSO1-like CXC 3 isoform X1
RefseqXP_020535282.11e-100protein tesmin/TSO1-like CXC 3 isoform X2
RefseqXP_020535283.11e-100protein tesmin/TSO1-like CXC 3 isoform X3
RefseqXP_020535284.11e-101protein tesmin/TSO1-like CXC 3 isoform X4
SwissprotF4JIF57e-56TCX2_ARATH; Protein tesmin/TSO1-like CXC 2
TrEMBLB9RV081e-85B9RV08_RICCO; Tso1, putative
STRINGXP_002517577.12e-86(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF142771417
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.13e-58TESMIN/TSO1-like CXC 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]