PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00332.40
Common NameJCGZ_11753, LOC105640657
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family SBP
Protein Properties Length: 555aa    MW: 60430.2 Da    PI: 8.0892
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00332.40genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.82.8e-42177252277
                    -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
            SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                    Cqv gC++dls+ keyh+rhkvCevhsk+++v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q
  Jcr4S00332.40 177 CQVYGCNKDLSSSKEYHKRHKVCEVHSKTAKVIVNGIEQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKPQ 252
                    **************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.2E-33172238IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.505174251IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.34E-39175254IPR004333Transcription factor, SBP-box
PfamPF031106.0E-32177250IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 555 aa     Download sequence    Send to blast
MQPWSYVHGG KDIVSRETIS SSDTIAKSRN ALLGWDLKTA SFGNNMVISS QQAIENQNFG  60
HLSYQEMMGK QLPDNSIRVS LSSEVDVGKI INPFIVNNTN SFSLEVESTS SRLSSSVMDS  120
NSRDSSFIDL KLGRFGDPTT DAQNSRTSKG ASILSSSDSS NPPKRMRPGV NSHTAYCQVY  180
GCNKDLSSSK EYHKRHKVCE VHSKTAKVIV NGIEQRFCQQ CSRFHLLAEF DDGKRSCRKR  240
LAGHNERRRK PQVGLHAGRT GRLIQSYNGF GTGRFHGTAS FICQDILPSG PLHPEKYGTN  300
NWCRQIKVED GSNFSPLSSI PTSGYLLSKF LFPSNNLNKA FLTFNDNEAT PTTGSIFNAS  360
SNRYPHEMGG SIFYSRSLVQ DNLMGNEDFT TFNAVSTIQG LSGITHSGCA LSLLSSHSNN  420
FSGHSSGMSI ASPLVVPGSN THYSVSQVSE KLIGVSSQAS MSGVPNKFSS GTSSAEGSHL  480
GSILIPDGSD AINFDVTDGI YQGSDFMNAK GSLSCEDGTT VDLLQLSSQL QRVEHQKQSM  540
QVKQENDALC WPHIT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-301772501184squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012080418.10.0squamosa promoter-binding-like protein 6 isoform X2
TrEMBLA0A067K5H80.0A0A067K5H8_JATCU; Uncharacterized protein
STRINGXP_002514625.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.14e-46SBP family protein
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]