PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00230.100
Common NameJCGZ_02215, LOC105632026
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family CPP
Protein Properties Length: 689aa    MW: 75362 Da    PI: 6.2495
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00230.100genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.25.1e-16393431240
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                      +k+CnCkkskClk+YCeCfaag++C e C+C++C+Nk 
  Jcr4S00230.100 393 ACKRCNCKKSKCLKLYCECFAAGVYCIEPCSCQECFNKP 431
                     589**********************************96 PP

2TCR50.63.7e-16478516139
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                     ++k+gCnCkks+ClkkYCeC++ g+ Cs +C+Ce+CkN 
  Jcr4S00230.100 478 RHKRGCNCKKSSCLKKYCECYQGGVGCSINCRCEGCKNA 516
                     589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.6E-17392433IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.486393518IPR005172CRC domain
PfamPF036381.3E-11395430IPR005172CRC domain
SMARTSM011142.9E-17478519IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.2E-11480516IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 689 aa     Download sequence    Send to blast
MDTPKKTQIT TPLSKFEDSP VFNYINSLSP IKPVKSIHVT QTFHSLSFAS LPSIFTSPHV  60
TSHKESRFLR RHNYSDQSKP EISSENGNKV GSNEGDVAQL YDDSRELQEN FDAGVSIAEA  120
SIEPPSEHAE FAIELPRRFK YDCGSPECDT MSCCGPHVDC MSELAGISAL EVSQKCADMH  180
LQGIHPTKRK KEAADCDWES LISDTADLLI FNSPIDSEVF KGLMQKSLDA GGSYPTPLDE  240
RLDNLTANNN PSEEVDNEVG MPIRIRVVSN LHRGMRRRCL DFEVVGAGRK NLVILQGVFL  300
PGIGLHLNAL AITSKDSKNV KNETLSSGIS LPSSVASFHS PTADEELNES LALVSVERDT  360
EPTENGVPPG EDVSQASASL VAEERKLEGE SEACKRCNCK KSKCLKLYCE CFAAGVYCIE  420
PCSCQECFNK PIHEDTVLAT RKQIESRNPL AFAPKVIRSS ESATEIGDEP SKTPASARHK  480
RGCNCKKSSC LKKYCECYQG GVGCSINCRC EGCKNAFGRK DGSAPMETEA EPEDETDGDE  540
KNGVDRISQK TEIQNNEEQN PNSALPMTPL PLCRPLLQLP FSSKGKPPRS FLGIGSSSGL  600
YTAQKYGKPN ILRPQTKFEK QLPTVPDDDM PEMLRGNYTP STGIKTSPNS KRISPPHSIL  660
GSSPGRRSGR KLILQSIPSF PSLTPPPLK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-1739751514120Protein lin-54 homolog
5fd3_B1e-1739751514120Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012069685.10.0protein tesmin/TSO1-like CXC 2 isoform X2
SwissprotF4JIF51e-173TCX2_ARATH; Protein tesmin/TSO1-like CXC 2
TrEMBLA0A067KVT50.0A0A067KVT5_JATCU; Uncharacterized protein
STRINGXP_002517089.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26193375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.11e-166TESMIN/TSO1-like CXC 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]