PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00229.100
Common NameJCGZ_15739, LOC105630572
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family SBP
Protein Properties Length: 510aa    MW: 56040.4 Da    PI: 7.4196
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00229.100genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP136.86.7e-43167242277
                     -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
             SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                     Cqv gC++dls++k+yh+rhkvCe+hsk+p+v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q
  Jcr4S00229.100 167 CQVYGCNKDLSSLKDYHKRHKVCEIHSKTPKVIVNGVEQRFCQQCSRFHLLVEFDDGKRSCRKRLAGHNERRRKPQ 242
                     **************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.1E-34161228IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.941164241IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.35E-40165245IPR004333Transcription factor, SBP-box
PfamPF031102.5E-32167240IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 510 aa     Download sequence    Send to blast
MECWRFAAEG KGLLFSDEID SSIDSYGRNR RVFTGWDGES VESTEFIDLS FSEIPKKPFH  60
ASSNTGAGML GSDEAGIDSC KIELTSPSYM IASNSSLESG SNHSNSLMES NSQDSSLIDL  120
KLGRLIDGKD AQNSKFLKER SVVSSVSPTS QPKRARTMSS RLQTPLCQVY GCNKDLSSLK  180
DYHKRHKVCE IHSKTPKVIV NGVEQRFCQQ CSRFHLLVEF DDGKRSCRKR LAGHNERRRK  240
PQFGALSGRH KLLQSYQVIC SGKEIAQACT VIDRPGXASL LFPNMLAGGI LSPDRHEASN  300
CYRPVKLEEK SVYNSNGQFV SKSFLRLHGN GIQNTSGICP SATDEFTRLN TASTVHELAG  360
VSHSSCALSL LSAESQDLSH SAGIIMARPS ISQANRSHHS VGISDKPFGV ESLEKYLPNG  420
FHSSGLNPFK SNHMGSFTVS YAGELQVEPD GFLQESDLLN AKYCASDENG STVDLLQLSS  480
HLHRVEQQRN SAQVKHEVED FSSFLTTYGA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-291662401084squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012067818.20.0squamosa promoter-binding-like protein 6
TrEMBLA0A067KYV70.0A0A067KYV7_JATCU; Uncharacterized protein
STRINGcassava4.1_005991m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.14e-57SBP family protein
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]