PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00200.30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family HB-other
Protein Properties Length: 1085aa    MW: 119675 Da    PI: 9.5772
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00200.30genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox20.57.9e-0769125157
                    TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
       Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                    +r+R  ++++ ++ +++ F  +  +s++e   ++++ g+t +qV+ +F  +Ra+ +k
  Jcr4S00200.30  69 KRPRDLLNPKAIKYMQAIFSIKDAISKKECHVISAQFGVTVTQVRDFFASQRARVRK 125
                    799***************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.24866126IPR001356Homeobox domain
SuperFamilySSF466891.03E-668128IPR009057Homeodomain-like
SMARTSM003895.4E-468130IPR001356Homeobox domain
CDDcd000861.33E-469125No hitNo description
PfamPF000462.2E-469125IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.609.2E-669136IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1085 aa     Download sequence    Send to blast
MEALKGNLEE IEIGSSVESF QKFLDSQKEL FHSQIDQLQS IVVAQCKLTG VNPLSQEMAA  60
GAMSIKIGKR PRDLLNPKAI KYMQAIFSIK DAISKKECHV ISAQFGVTVT QVRDFFASQR  120
ARVRKLVRLS REKTSRTNVC KEPQEGAATS SDSMMPINLA PLNSVHPDPV PIGSLGCNPV  180
PLNSVSPDSA PLNYIGHDPA PLNSIGHDPA PLNAIGHSNV EEAPSCSTQD DLIPGLHDLD  240
KHFVENIFYL LRKEETFSGQ VKLMEWILRI RNPSVLSWFL NKGGVMILAT WLSQAAAEEQ  300
TSVLCHMPLH KSLPEHMSAI LHSVNRLRFY RTSDISNRAR VLLSRWSKMF ARSLKKPNGI  360
KSSVDEQEMI LKRSIDEIMG NELWHSDVSN PENAITLSES SENIRKMEPS QTLKLLPASE  420
DSSRKHILGV SSSLSVVQEE LDSNDSSPFC VSGVPDTRER RKVQLVEQPG QKTAGRSPQA  480
TKPVSVNQGR PMSTDDIQKA KMRALFMQSK YGKTGSSSNG PNGTKTEGLN KPSNTSSGNL  540
FPASKVPLRP KIEEQKKPVI VPTVISNKQG PLDPKHKMGL KEPLGEFCRR VQIPWQTPPV  600
AIRQAKGGKR CRLAVADHQI KLNNHWRVGT GENSKEVDVQ KNRNRREIET IYHTVQEIPF  660
NPKEPWDLEM DYDDTLTPDI PIEQPPDTDG SEAQLPNNET AAASVAPSLP QIGGGSASEP  720
DLELLAVLLK NPELVFALTS GQAGNLSTED TVKLLDVIKR SGNGLAGSLN GFSGKVEEKV  780
EVSLPSPTPS SNPGTNSWCQ WGKLEQVSGR VLCLMKCAFP AIRGPVKKIM SGWRPEVAKN  840
PFSRENRVPQ VQTNIYSSLL QPQSHNQGSD FRTSQRQATM QLLSQQLQAA MPSFSLPQTT  900
STIPDNRQPS MLLPLHQNSS MLQTSASEMG LQKYSSTTGP SFAMSTPERR PVSFPIATPT  960
PVVHSSSRLS STGNMGSMPG SWRAGQGLAS NSISQVKQNN YEPPSYRGSV QPQLRAGAPN  1020
WERNEGFESW SPENSPVRSP EYIAGSNYPG SRVNSGRNYN PDNRNRQRNY PGQRELNRNG  1080
NRRWH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012082704.10.0homeobox protein LUMINIDEPENDENS
TrEMBLA0A067JW280.0A0A067JW28_JATCU; Uncharacterized protein
STRINGcassava4.1_000740m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF98092934
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.20.0HB-other family protein