PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00115.240
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family HD-ZIP
Protein Properties Length: 262aa    MW: 29767.8 Da    PI: 8.7156
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00115.240genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.64.3e-1855107456
                     -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     + +++ eq+++Le+ Fe  +++  e++ +LAk lgL+ rq+ +WFqNrRa++k
  Jcr4S00115.240  55 KKRLNLEQVKALEKSFELGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWK 107
                     4568889*********************************************9 PP

2HD-ZIP_I/II130.75.7e-4253145193
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                     ekk+rl+ eqvk+LE+sFe  +kLeperK++la++Lglqprq+a+WFqnrRAR+ktkqlEkdye+Lk+++dalk++n++L++++++L++el++
  Jcr4S00115.240  53 EKKKRLNLEQVKALEKSFELGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWKTKQLEKDYEVLKKQFDALKADNDSLQAQNKKLHAELMA 145
                     69**************************************************************************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-1926110IPR009057Homeodomain-like
SuperFamilySSF466892.35E-1946111IPR009057Homeodomain-like
PROSITE profilePS5007116.97349109IPR001356Homeobox domain
SMARTSM003891.5E-1752113IPR001356Homeobox domain
CDDcd000861.27E-1554110No hitNo description
PfamPF000462.4E-1555107IPR001356Homeobox domain
PRINTSPR000318.7E-68089IPR000047Helix-turn-helix motif
PROSITE patternPS00027084107IPR017970Homeobox, conserved site
PRINTSPR000318.7E-689105IPR000047Helix-turn-helix motif
PfamPF021837.2E-16109147IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MISLQVYYKS SFDYQGGGGH FLMKRSMSFS GLEKCEEVHG DDDLSDDGSQ LGEKKKRLNL  60
EQVKALEKSF ELGNKLEPER KMQLAKALGL QPRQIAIWFQ NRRARWKTKQ LEKDYEVLKK  120
QFDALKADND SLQAQNKKLH AELMALKCRD SNEVNAKKEN EGSWSNGSEN SCEANNLDIS  180
RTHQVATSPV SNTQLSTKHL FTTTSIRPTS MTQLLHSSSR PDLQCLKVDN LVQEVKFLLI  240
CSMELKSIMD FGHGKSSMHL SH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1101109RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012083177.11e-150homeobox-leucine zipper protein HAT7
SwissprotQ004661e-68HAT7_ARATH; Homeobox-leucine zipper protein HAT7
TrEMBLA0A067LM691e-149A0A067LM69_JATCU; Uncharacterized protein
STRINGPOPTR_0017s11800.11e-123(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15150.12e-60homeobox 3