PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00055.70
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family CPP
Protein Properties Length: 771aa    MW: 85568.5 Da    PI: 6.3508
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00055.70genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR48.22.2e-15406444341
            TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                    +++CnCk+skClk+YCeCfaag++C  +C+Ce+C+N+ e
  Jcr4S00055.70 406 CRRCNCKRSKCLKLYCECFAAGVYCVRSCTCENCFNRPE 444
                    789*********************************876 PP

2TCR49.58.4e-16492531140
            TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                    ++k+gCnCkkskClkkYCeC++a++ Cs+ C+Ce+C+N+ 
  Jcr4S00055.70 492 RHKRGCNCKKSKCLKKYCECYQAKVGCSSGCRCEGCNNSF 531
                    589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.4E-15404445IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163434.63405532IPR005172CRC domain
PfamPF036381.7E-11407442IPR005172CRC domain
SMARTSM011145.0E-16492533IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.9E-11494530IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 771 aa     Download sequence    Send to blast
MCLLSEKIDY NSEESALFNY LTNLSPIKSV KGARYVQRFS QTNFSIPQPV FTSPRVGQHR  60
QTSFIKREEI DLADSDVYVH GDDTHLKSQL IHCYQKEDQL VSPSEYLADP AEMEENTNST  120
SLQAQPHNDR PKILETGFTS HEDTTIKNDD HDNSNMFLVP FSGAQHHEQF AVQAADGQDS  180
KDSGNYLSFH QPLQSVQAYK NSAESSRSVP RGSSKEADQH QRGIRRHLQF GVTIPCKHTD  240
NDAHDNANLS LPEHVPNFES LVPHQIEPSG IFGSWLAGSH AQAITFLSSF CPSQSLRSAQ  300
NCVNHDMSAA CTPSVLGLPS SSFTISGSVG SDSKTSMILA CNLHAQEEKQ MPNRTHTSAN  360
DLASISISSV SGEIHACMDD DHQENQAAAT VAARKRTKPV DDSEGCRRCN CKRSKCLKLY  420
CECFAAGVYC VRSCTCENCF NRPEYEDTVL DTRQQIQARN PLAFAPKVVI PGMNSPANLL  480
EDGNWTTPSS ARHKRGCNCK KSKCLKKYCE CYQAKVGCSS GCRCEGCNNS FGKKTVESKL  540
TFHDDDNAES IYRSAEKWEN ISHEQLETLE SPDGFVKAGR AHQVSSXXYE PYDSNVASSL  600
RSSGYFSFSE YSLTPKSYGT EALTEISSDS LFYNILKEDD TPEALKYTFT PTKAVKVTSP  660
NQKRVSPPQN RSQELRSSSS QGLQSGRKFI LPAVPSFPPL TPYSKLKDEN QQTDDSGPIL  720
LKADRQRVAC CFSQDIFQET ADRACHYLQD ILEALLPAML QNFGLFLPVQ G
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A5e-1740952914120Protein lin-54 homolog
5fd3_B5e-1740952914120Protein lin-54 homolog
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0119750.0AP011975.1 Jatropha curcas DNA, clone: JHL25H03, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020535282.10.0protein tesmin/TSO1-like CXC 3 isoform X2
TrEMBLA0A067KXY60.0A0A067KXY6_JATCU; Uncharacterized protein
STRINGcassava4.1_026451m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF142771417
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.17e-61Tesmin/TSO1-like CXC domain-containing protein