PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00028.70
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family HD-ZIP
Protein Properties Length: 858aa    MW: 93867.2 Da    PI: 6.3688
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00028.70genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.48e-21118173156
                    TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                    ++k +++t++q++eLe +F+++++p++++r eL+++lgL+ +q+k+WFqNrR+++k
  Jcr4S00028.70 118 KKKYHRHTPHQIQELEVFFKECPHPDEKQRLELSRRLGLESKQIKFWFQNRRTQMK 173
                    79999************************************************999 PP

2START113.82.6e-363235072165
                    HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEE CS
          START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetlev 84 
                    la++a++el+k a+ + p+W+ks     + + ++e++++f++  +     + +ea r++g+ + ++  lve+l+d++ qW e +     +a++++v
  Jcr4S00028.70 323 LALAAMDELIKIAQIDGPVWMKSLdggkDVLHYEEYTRTFSPCISmkpssFVTEATRETGLIIINSLALVETLMDVN-QWVEAFSslvaRASVIDV 417
                    6899**********************9999**********99888999*99**************************.****************** PP

                    ECTT.......EEEEEEE.EXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEE CS
          START  85 issg.......galqlmv.aelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvt 165
                    issg       galq+m   ++  +splvp R + f+R+++q+ +g+w++vdvS+d +q+ +   ++  +++lpSg+++++++ng +kv+
  Jcr4S00028.70 418 ISSGmaagsknGALQVMHgGSFKCISPLVPvRQVRFLRFCKQHAEGVWAVVDVSIDANQESSDVNPFNVCRRLPSGCIMQDMPNGCCKVI 507
                    ****************97258899************************************9997888888******************98 PP

3START40.47.6e-14542587160206
                    CEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
          START 160 ghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                    g  +vtwveh +++++++h+l+r +++sg  +ga++wvatlqr+ce+
  Jcr4S00028.70 542 G-GEVTWVEHSEYDESVVHQLYRTVLSSGGGFGAQRWVATLQRYCEC 587
                    4.58*****************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-21104175IPR009057Homeodomain-like
SuperFamilySSF466891.55E-20104175IPR009057Homeodomain-like
PROSITE profilePS5007117.929115175IPR001356Homeobox domain
SMARTSM003893.7E-18117179IPR001356Homeobox domain
PfamPF000462.1E-18118173IPR001356Homeobox domain
CDDcd000864.66E-19118175No hitNo description
PROSITE patternPS000270150173IPR017970Homeobox, conserved site
PROSITE profilePS5084835.728313590IPR002913START domain
SuperFamilySSF559612.06E-23313502No hitNo description
CDDcd088751.76E-98317586No hitNo description
SMARTSM002344.1E-21322587IPR002913START domain
PfamPF018522.0E-29323507IPR002913START domain
PfamPF018523.5E-10537587IPR002913START domain
SuperFamilySSF559612.06E-23542587No hitNo description
SuperFamilySSF559616.32E-20615851No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 858 aa     Download sequence    Send to blast
MGLCCREGRI VSNSFNRGGG GSSNIVVDIV THSTNMHSGA IAQPPLLASS IPKSPALSLS  60
IKGKMDDHGD MGLLGEPFDP SIVGRIKEDG YESRSGSDNL EGASGDDQEA GDHQRRRKKK  120
YHRHTPHQIQ ELEVFFKECP HPDEKQRLEL SRRLGLESKQ IKFWFQNRRT QMKTQLERHE  180
NIILRQENDK LRAENELLKL NMTDPICNSC GGPVVPGPVS FEQQQLRIEN ARLKDELGRV  240
CALANKFLGR PLSSSASPVA PFGSNSKLDL AVGRNGYGVL GNVEAPLPMG LDFNDDITMP  300
LMKPMTSPVT NGVPYDRSMF IDLALAAMDE LIKIAQIDGP VWMKSLDGGK DVLHYEEYTR  360
TFSPCISMKP SSFVTEATRE TGLIIINSLA LVETLMDVNQ WVEAFSSLVA RASVIDVISS  420
GMAAGSKNGA LQVMHGGSFK CISPLVPVRQ VRFLRFCKQH AEGVWAVVDV SIDANQESSD  480
VNPFNVCRRL PSGCIMQDMP NGCCKVILGS FNLHVINYIF DASIPISYAY TDGYMLCPCI  540
TGGEVTWVEH SEYDESVVHQ LYRTVLSSGG GFGAQRWVAT LQRYCECMAI LASPTISGED  600
QTGINLSGKK SMLKLAQRMV DNFCCGVSAS SVRKWDKLLV GNVGENVRIL TRKNVNDPGE  660
PPGVVLSAAT SVWLPVMRQR LFDFLRDERL RCEWDILSHG GLMQEMVHIT KGNSSGNCVS  720
LLRSSAVSPN TNESNMLILQ ETWNDASNSL VVYAPVDIPS MSVVMNGGDS TYVALLPSGF  780
VIVPDDSLRQ GGPNFCNGNL VKRDSDGNDG AGSLLTVGFQ ILVNNLPTAK ITVESVETVN  840
NLISCTIQRI KAALQLNS
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012090292.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A067JEK70.0A0A067JEK7_JATCU; Uncharacterized protein
STRINGXP_002510822.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]