PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00021.60
Common NameJCGZ_07240
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family M-type_MADS
Protein Properties Length: 320aa    MW: 36596 Da    PI: 8.93
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00021.60genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF50.13.6e-161051243
                   ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
         SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                    i n++ r vt+ kR++g+ KK +E  vLCd++++viif+++
  Jcr4S00021.60 10 LITNERSRMVTYQKRKKGLTKKLHEFRVLCDVDACVIIFGPK 51
                   699*************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554557.98E-20179IPR002100Transcription factor, MADS-box
PROSITE profilePS5006619.231151IPR002100Transcription factor, MADS-box
SMARTSM004322.1E-17155IPR002100Transcription factor, MADS-box
CDDcd001204.90E-21259No hitNo description
PRINTSPR004044.0E-11323IPR002100Transcription factor, MADS-box
PfamPF003191.2E-171151IPR002100Transcription factor, MADS-box
PRINTSPR004044.0E-112338IPR002100Transcription factor, MADS-box
PRINTSPR004044.0E-113859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MGRGKLSMKL ITNERSRMVT YQKRKKGLTK KLHEFRVLCD VDACVIIFGP KFSNRPIDVD  60
TCPTDHSEIK KIIDRYKSHG NDRKKSQDLS HFFETRKRKL DDEITKMHRA CLEAKFPTWD  120
NRLNSSALEE LCLLHTVLQS KLETAMSRIL KIKGDNYLMI GEDSKSVNII QGSSSNNNIN  180
NRYNSMASTF ANALQQKCTE LQQPFDHHQV LPFNVNPLNS PMMMMMMMKA NGTDLSQFGA  240
QEADQTAGNM VILNNHNGGI PHPVSYCGEM RQLSLLGSGQ GSIMPNVSSQ MQVPQFSEFC  300
DTNEFEMKNM KRQCLEYFKY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18298RKKSQDLSHFFETRKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020536507.10.0MADS-box protein JOINTLESS-like
TrEMBLA0A067KPF80.0A0A067KPF8_JATCU; Uncharacterized protein
STRINGXP_002514306.11e-99(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.11e-23M-type_MADS family protein
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]