PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00021.330
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family CPP
Protein Properties Length: 506aa    MW: 54901.2 Da    PI: 7.5641
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00021.330genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR51.22.5e-16176215140
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  Jcr4S00021.330 176 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCMDCKNFE 215
                     589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5163421.06135216IPR005172CRC domain
SMARTSM011148.4E-20176217IPR033467Tesmin/TSO1-like CXC domain
PfamPF036389.4E-13179214IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 506 aa     Download sequence    Send to blast
MGEGEGSEFP PKKAAQSETQ GGSDFPAKKL ARQLDFTQGN VVLPDHPQSQ QQPATLPLPL  60
KPVVITPQSQ PQQQPLQPQV LSMSAAPPPQ QLPPVRIVKP ESPKSKPRPN AELKDGIDML  120
PCFLMELSQM AVSFRREAVE ATLERNPNAF RPKIASSPHG TRDSREENGE GLVLGKHNKG  180
CHCKKSGCLK KYCECFQANI LCSENCKCMD CKNFEGSEER QALFHGDHAN NIAYIQQAAN  240
AAITGAIGSS GYASPPVSKK RKGQELLFGP TVKDPRPGNF QQLACHLHFH QAPHVRPSAP  300
SSSLSTNPVT RAGTAAALGP SKFTYRSLLA DIIQPQDLKE LCSVLVVVSE EAAKALADQR  360
NASEKRVEDQ TETSLASSTQ ERLQSQKEAD AEKINAYDCS IANQADKVGP DGSSSDGADV  420
PKGRPMSPGT LALMCDEQDT MFMTAASPNR LTGHGCSFTS QLPCGQGMTE IYAEQERIVL  480
SKFRDCLNRI IMFGELKGKF FTYSLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-2313522553132Protein lin-54 homolog
5fd3_B2e-2313522553132Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00045PBMTransfer from AT4G29000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2142821e-107AC214282.1 Populus trichocarpa clone POP018-K04, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012076721.10.0protein tesmin/TSO1-like CXC 5 isoform X1
RefseqXP_012076722.10.0protein tesmin/TSO1-like CXC 5 isoform X1
RefseqXP_020536631.10.0protein tesmin/TSO1-like CXC 5 isoform X1
SwissprotQ9SZD11e-169TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A067KPI70.0A0A067KPI7_JATCU; Uncharacterized protein
STRINGcassava4.1_023118m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26263379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-147Tesmin/TSO1-like CXC domain-containing protein