PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00003.390
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family NF-YA
Protein Properties Length: 365aa    MW: 39855.8 Da    PI: 7.3165
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00003.390genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA103.22.3e-32193249158
       CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                     +ep+YVNaKQyq+Il+RRq+Rak+e ekkl +k rkpylheSRh+hA+rR+Rg+gGrF
  Jcr4S00003.390 193 QEPVYVNAKQYQGILRRRQARAKAELEKKL-IKVRKPYLHESRHQHAMRRARGTGGRF 249
                     69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005218.0E-36191252IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.003192252IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.8E-28194249IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006164.0E-24195217IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860197217IPR018362CCAAT-binding factor, conserved site
PRINTSPR006164.0E-24226249IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010262Biological Processsomatic embryogenesis
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0055046Biological Processmicrogametogenesis
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MQSKSESTNR LDPNPHVIQP YAVHSEPWWR SIGYNVASTM ARENASNLSS AEGPNDSLSN  60
DDQSLSNGRL NEEDDAASKE SQATASSRSV VNSGQEHKNL QHVASSMTTM HEECLAQHPQ  120
LELVGHSIAC ASNPYQDPYY GGMMAAYGHQ SLSVAIPFIV VDLAIRDSVP ITGYPHLLGM  180
HHARMPLPHE MAQEPVYVNA KQYQGILRRR QARAKAELEK KLIKVRKPYL HESRHQHAMR  240
RARGTGGRFA KKTGADAYNN MTEGKVNDSG PIPSSQSGSS SGSEPLPSDS ADVWIFSHGQ  300
QDTRAPNVHG TLEANNHLNG GSHHHNHSGS THHSSAGEKD DGDFSGQKRV SFSSNQASQR  360
PLAIQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-18193249258NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012090013.10.0nuclear transcription factor Y subunit A-1
SwissprotQ9LXV59e-74NFYA1_ARATH; Nuclear transcription factor Y subunit A-1
TrEMBLA0A067JH140.0A0A067JH14_JATCU; Uncharacterized protein
STRINGcassava4.1_010819m1e-172(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40123461
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.33e-70nuclear factor Y, subunit A1
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Siriwardana CL, et al.
    NUCLEAR FACTOR Y, Subunit A (NF-YA) Proteins Positively Regulate Flowering and Act Through FLOWERING LOCUS T.
    PLoS Genet., 2016. 12(12): p. e1006496
    [PMID:27977687]
  3. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]