PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00002.200
Common NameJCGZ_08014, LOC105635152
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family SBP
Protein Properties Length: 1043aa    MW: 115683 Da    PI: 8.2255
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00002.200genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.65.6e-41150227178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +Cqv++C++dls+ak+yhrrhkvCevhsk++++lv +++qrfCqqCsrfh lsefDe+krsCrrrLa+hn+rrrk+q+
  Jcr4S00002.200 150 MCQVDNCKEDLSNAKDYHRRHKVCEVHSKSTKALVGKQMQRFCQQCSRFHPLSEFDEGKRSCRRRLAGHNRRRRKTQP 227
                     6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.107.9E-34145212IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.983148225IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.31E-37149229IPR004333Transcription factor, SBP-box
PfamPF031101.3E-29151224IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1043 aa     Download sequence    Send to blast
MEEVGAQVAP IFIHQPLSGL FCDATPLPKK RDLSYQAPNF QLQQQHRFVQ NPRDNWNPKA  60
WDWDSVRFVA KPSDADANSN ILQLGITSSE LNKKKVEASG NRLPLKNAKL DEDDGLRLNL  120
AGGLSSVEEP VSRPNKRVRS GSPGTATYPM CQVDNCKEDL SNAKDYHRRH KVCEVHSKST  180
KALVGKQMQR FCQQCSRFHP LSEFDEGKRS CRRRLAGHNR RRRKTQPEDV ASRLLLPANH  240
DTTSTANLDI VNLLTVLART QGKNEEKSIN NNSSVPDREQ LIRILSKINS LPLPVDLAAK  300
LSNIASLNRK TAAQLSPEQQ KILHGTASSP STMDLLAVLS ATLAASAPDA LAILSQRSSQ  360
SSDSEKSRLT CIDQATGPNM QKRPVIDLPA VGGERSSSCY RSPIEDSGCQ LKEKFPNLPL  420
QLFGSSPENN SPPKMASSMK YFSSDSSNPS EGQSPSSSPP VVQKLFPMQS TTETVKSEKM  480
SVSREVNANV EGSRTHGCIL PLELFRSSNS GADQSSFQNF PYQAGYTSSS GSDHSPSSQN  540
SDAQDRTGRI IFKLFDKDPS HFPGKLRSQI YNWLSNSPSE MESYIRPGCV VLLKEICSGK  600
SNSLVQDSCS DFWRSGRFLL HTGRQLASHK DGNGSFMQIL ENMEFPRVAV SVPSGSXRLI  660
HDSCRIHCTY MGGYTSKEIT GSISPRAMHD EINMNGFKIH GASPSVLGRC FIEVENGFKG  720
NSFPLIIADA TICKELRLLE SEFDEGTEET DIISEEQAQC LGRPRSREEV WHFLNELGWL  780
FQRRAFSMFE LPDFSLSRFK FLLIFSVERD YCVLIKTVLD MLVERNLDMN GLSKESLDML  840
SEVQLVNRAV KRRCRKMVDL LIHYSINNND VSSRSYIFPP NLPGPGGITS LHLAACTSGS  900
DDLVDALTND PQEIGLSCWN SLLDANDQSP YAYAIMTNNH SYNTLVARKL ADRRNSQVSL  960
TIGTEMGQPY FQQGRRSCAR CAAVAAKYNR SIRGSQGLLQ RPYVHSMLAI AAVCVCVCLF  1020
LRGAPDIGLV APFKWETLDY GTI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-31141224184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1847852RAVKRR
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May play a role in plant development. {ECO:0000250, ECO:0000269|PubMed:15703061}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00155DAPTransfer from AT1G20980Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFQ3842951e-45FQ384295.1 Vitis vinifera clone SS0AAG20YM14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012073540.10.0squamosa promoter-binding-like protein 14
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLA0A067KP350.0A0A067KP35_JATCU; Uncharacterized protein
STRINGcassava4.1_000685m0.0(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96943139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]
  3. Liu J, et al.
    Characterizing Variation of Branch Angle and Genome-Wide Association Mapping in Rapeseed (Brassica napus L.).
    Front Plant Sci, 2016. 7: p. 21
    [PMID:26870051]