PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc004953.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family CPP
Protein Properties Length: 872aa    MW: 94458 Da    PI: 6.791
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc004953.1_g00001.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR48.41.9e-15471509341
                      TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                              +k+CnCk+skClk+YC+Cfaag +C+e C C++C+N+ e
  Itr_sc004953.1_g00001.1 471 CKRCNCKRSKCLKLYCDCFAAGIYCAEPCACQGCFNRPE 509
                              79**********************************876 PP

2TCR49.21e-15558596139
                      TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                              ++k+gCnCk+s ClkkYCeC++a++ Cs+ C+Ce+CkN 
  Itr_sc004953.1_g00001.1 558 RHKRGCNCKRSMCLKKYCECYQANVGCSSGCRCEGCKNV 596
                              589***********************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011149.0E-17469510IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163435.113470598IPR005172CRC domain
PfamPF036381.9E-11472507IPR005172CRC domain
SMARTSM011143.7E-17558599IPR033467Tesmin/TSO1-like CXC domain
PfamPF036382.3E-11560595IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 872 aa     Download sequence    Send to blast
MDSPVPSKTT ATPTSAAAAS SFSVSESAAV QVHFNLFLDV EESPFSNYLS SLSPIGPVKT  60
AIVVQDFPGI ITPPHVFTSP RINPRIASSF LERGPFLQLP NEEFSVKDDS QNNVSTLRDQ  120
AGSSNTQLNS GFVPRTDKVS DNNSPVQEQT ESQPICVDDF LVDAAKLGSV DSKNSSLQQA  180
DGLIGSKESV DLKGKENKNN NEIEMATGDI NSMKTNGKDD AESVPSSKMQ PHSSLENQYD  240
HRGTSEAGEH QRGVFRRCLQ FEDVQPKTAL TPDPCNLSES VNCSNSAVSP IALEALESFP  300
LNTPTAQSSR QFGDTQNTEN SSFKTPKPSG IGLHLNSIVS TVQGGSGATV SMTAERGNFS  360
LQGKKLMSMT SHLEKSKKCL ISSNVGEDIL ASIEESSLQG ESSAPLPLHS VKPIDSIASL  420
KPMKCLSTPG NKRKSSSENI DGTMASNQSS PKKKRQAYLK KTSDASDGDG CKRCNCKRSK  480
CLKLYCDCFA AGIYCAEPCA CQGCFNRPEY EDTVLETRQQ IESRNPLAFA PKVVQHMTDS  540
HSNIVGDTGV SFTPSSARHK RGCNCKRSMC LKKYCECYQA NVGCSSGCRC EGCKNVYGQK  600
EEYGRIKTLV KKLGTFEQTE LSNPHNLTPL TPSFQCSDHR NDASKSWFTS GRCSQSPESG  660
HTLIPRYGVS KKGFTKSSDN PESIEETTDI MDLVSFDPEM EDNNSAAANE YSPGEMNQLV  720
VLPNSQQWVN DSRERLYAGP CHLSSTSSFG WRSSPMTPMT QYDGSKEFYE SINSGKSSFN  780
AIEDDTPEIL KDASTPPGGV KVSSPNKKRV SPPHGRLKDP DDGSSSARRL KAGRKYKLGS  840
VPSFPPLTPC FVSKGSSEDQ IKNDTQKPSS SP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A7e-1947461014131Protein lin-54 homolog
5fd3_B7e-1947461014131Protein lin-54 homolog
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019167925.10.0PREDICTED: protein tesmin/TSO1-like CXC 2
RefseqXP_019167927.10.0PREDICTED: protein tesmin/TSO1-like CXC 2
RefseqXP_019167928.10.0PREDICTED: protein tesmin/TSO1-like CXC 2
TrEMBLA0A484N9930.0A0A484N993_9ASTE; Uncharacterized protein
STRINGSolyc08g067150.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA69802128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.14e-63TESMIN/TSO1-like CXC 2