PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc003239.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family ARF
Protein Properties Length: 906aa    MW: 101409 Da    PI: 7.0732
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc003239.1_g00004.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B356.93.8e-18186306199
                              EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE.....................EEETTEEEE CS
                       B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliy...................rkksgryvl 61 
                              f+k+lt sd++++g +++ +++a+e+      + + + +++l+ +d++g++W++++i+                     +++r++l
  Itr_sc003239.1_g00004.1 186 FCKTLTASDTSTHGGFSVLRRHADEClppldmSRQ-PPTQELVAKDLHGNEWRFRHIFrgiipyvlnnplpdcmmfgLSQPRRHLL 270
                              99*****************************7333.34459***************999**********99999999999999*** PP

                              -TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                       B3  62 tkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                              ++GW+ Fv++++L +gD ++F   + +++el+v+v+r+
  Itr_sc003239.1_g00004.1 271 QSGWSVFVSSKRLVAGDAFIFL--RGENGELRVGVRRA 306
                              **********************..449999*****996 PP

2Auxin_resp116.42.4e-38331413183
               Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                              a+ha++tk++F+v+Y+Pr+s++eF++++++++++ k+++++GmRfkm+fe+e+++e+r++Gt+vg++d dp rW++SkWr+Lk
  Itr_sc003239.1_g00004.1 331 AWHAIQTKTIFTVYYKPRTSPAEFIIPYDQYMESEKSNYTIGMRFKMRFEGEEAPEQRFTGTIVGIEDGDPQRWQESKWRCLK 413
                              89*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.83E-35182334IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.107.1E-38182320IPR015300DNA-binding pseudobarrel domain
CDDcd100176.93E-18184305No hitNo description
SMARTSM010195.2E-13186307IPR003340B3 DNA binding domain
PfamPF023622.4E-15186306IPR003340B3 DNA binding domain
PROSITE profilePS5086310.673186307IPR003340B3 DNA binding domain
PfamPF065077.8E-35331413IPR010525Auxin response factor
PfamPF023095.5E-11773865IPR033389AUX/IAA domain
PROSITE profilePS5174523.828780862IPR000270PB1 domain
SuperFamilySSF542778.34E-13781857No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009737Biological Processresponse to abscisic acid
GO:0009911Biological Processpositive regulation of flower development
GO:0010047Biological Processfruit dehiscence
GO:0010150Biological Processleaf senescence
GO:0010227Biological Processfloral organ abscission
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 906 aa     Download sequence    Send to blast
MASRQRLTPV RRRSNSPPLL VVRLSPQRLL LHWLLPVAGN SHRLLPVAKR EVSIKGYAEQ  60
NDVGARGVSC AGKVDAETAL YTELWRACAG PLVTVPREGE LVYYFPQGHI EQVEASTNQV  120
ADQQMPMYNL PSKILCRVVN VHLKAEPDTD EVYAQVTLMP VPDHDENAVK KENMPPPPPR  180
FHVHSFCKTL TASDTSTHGG FSVLRRHADE CLPPLDMSRQ PPTQELVAKD LHGNEWRFRH  240
IFRGIIPYVL NNPLPDCMMF GLSQPRRHLL QSGWSVFVSS KRLVAGDAFI FLRGENGELR  300
VGVRRAMRHQ GNAPSSVISS HSMHLGVLAT AWHAIQTKTI FTVYYKPRTS PAEFIIPYDQ  360
YMESEKSNYT IGMRFKMRFE GEEAPEQRFT GTIVGIEDGD PQRWQESKWR CLKVRWDETS  420
SVPRPDRVSP WNIEPALTPP ALNPLPVPRP KRPRSNNLPS SPDSSVLTRE GSSKLCADPS  480
PASGFSRVLH GQELSTLRGT FAESNESNSS EKPMVWPPSL EDEKIDVLSE SRRCGSDKWL  540
PLGRPEPSFT DLLSGFGTQM NSSCGFSLQP GDQTSATVSL TKRQKQYQEG SLLGKPWSIV  600
PSGLSLNLMD SGIKPHGQGS DAPYQARGDS RYGGHIECSM PPGHNVDNQQ GSWLGRQPVP  660
YLQMPAHARE RMLNPMLMQQ HEAMKPKEGN CKLFGIPLIS NSPTTDTEIL HKNTTIESGH  720
LHIGIQSHHS HVVESDQRLE QSNGSKVVDD GVTGNEEEKL FHIQPADKDR ERKVHSGSTR  780
SCTKVHKQGT ALGRSVDLTK FNNYDELLAE LDKLFDFNGE LKAMNKNWMV VYTDDEGDMM  840
LVGDDPWQEF CGMVRKIYIY TKEEVQRMNP GTLNSKDEDT SSVAEGLDTR EVKNSQIPSA  900
CSAEEC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1677943518354Auxin response factor 1
4ldw_A1e-1677943518354Auxin response factor 1
4ldw_B1e-1677943518354Auxin response factor 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00574DAPTransfer from AT5G62000Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009769542.10.0PREDICTED: auxin response factor 2-like isoform X1
RefseqXP_016476812.10.0PREDICTED: auxin response factor 2-like
SwissprotQ94JM30.0ARFB_ARATH; Auxin response factor 2
TrEMBLQ2LAJ30.0Q2LAJ3_SOLLC; Auxin response factor
STRINGSolyc03g118290.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA26182444
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.30.0auxin response factor 2