PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc003230.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family ARF
Protein Properties Length: 852aa    MW: 94417.3 Da    PI: 6.7908
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc003230.1_g00002.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B374.71.1e-23149250199
                              EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEE CS
                       B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvv 81 
                              f+k+lt sd++++g +++ +++a+e+     ++ ++ s++l+ +d++g +W++++i+r++++r++l++GW+ Fv++++L +gD ++
  Itr_sc003230.1_g00002.1 149 FCKTLTASDTSTHGGFSVLRRHADEClppldMSRQPPSQELVARDLHGSEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFI 234
                              99*****************************444556679********************************************** PP

                              EEE-SSSEE..EEEEE-S CS
                       B3  82 Fkldgrsefelvvkvfrk 99 
                              F   + +++el+v+v+r+
  Itr_sc003230.1_g00002.1 235 FL--RGENGELLVGVRRT 250
                              **..449999*****996 PP

2Auxin_resp117.98.1e-39275357183
               Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                              a+ha++tk++F+v+Y+Pr+s++eF+++ ++++++lk+++s+GmRfkm+fe+e+++e++++Gt+vg++d+d  rWp+SkWr+Lk
  Itr_sc003230.1_g00002.1 275 AWHAIQTKTMFTVYYKPRTSPAEFIIPHDQYMESLKNNYSIGMRFKMRFEGEEAPEQKFTGTIVGIEDCDHQRWPESKWRCLK 357
                              89*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.104.1E-41141264IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.08E-40145278IPR015300DNA-binding pseudobarrel domain
CDDcd100172.07E-21147249No hitNo description
PROSITE profilePS5086312.026149251IPR003340B3 DNA binding domain
SMARTSM010197.8E-23149251IPR003340B3 DNA binding domain
PfamPF023623.0E-21149250IPR003340B3 DNA binding domain
PfamPF065078.1E-36275357IPR010525Auxin response factor
PfamPF023099.9E-9727813IPR033389AUX/IAA domain
PROSITE profilePS5174521.945729811IPR000270PB1 domain
SuperFamilySSF542779.32E-11731807No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 852 aa     Download sequence    Send to blast
MATTEVSAAT GRGYAESSCG SCAPAPDGGR SVSGAGKDVE RALYTELWRA CAGPLVTVPR  60
EQELVFYFPQ GHIEQVEAST NQVAEQQMPI YKLPWKILCR VVNVLLKAEA DTDEVYAQVT  120
LMPEENQDEN AIKKETVPPS PPHVQVHSFC KTLTASDTST HGGFSVLRRH ADECLPPLDM  180
SRQPPSQELV ARDLHGSEWR FRHIFRGQPR RHLLQSGWSV FVSSKRLVAG DAFIFLRGEN  240
GELLVGVRRT MRHQNNIPSS VISSHSMHLG VLATAWHAIQ TKTMFTVYYK PRTSPAEFII  300
PHDQYMESLK NNYSIGMRFK MRFEGEEAPE QKFTGTIVGI EDCDHQRWPE SKWRCLKVRW  360
DETSTIPRPD RVSPWQIEPS LCPSALNPLP VPRTKRPRSN AFPSSPDSSV LTREGSSKLS  420
IDPSPASGFS RVLQGQELST LRGAFAESKE SESSEKPTPC PPSVNDEKLD DLYASHRCSS  480
NKRLSLGRPE SSFTALLSSG FGMYINSSHG LSLQSGDQMP VPASLVKQQS KYQEGEFNLL  540
GKPWPAVPSA SGLSLNLMDS SRKPHGQGSD TPYQTPGDSR RGGLSEYSML PGHRLDSQQG  600
NWFMPTTSYL QIPAHSRELM PKPVSVQQHE AFEPKKENCK LFGIPLISNS SSMGPPMLSE  660
YPMTESIVHS DLGISSHQSP AIESEQRSEQ PKDSKVINGV TGNEKEKELQ TFHVDGRGRA  720
GKVCSGSTRS CTKVHKQGTA LGRSVYLAKY NNYDELIAEL DNLFDFNGEL KARNSNWMVV  780
YTDGEGDMML VGDDPWQEFC AMAHKIHLYT KEEVQHMKPG TLNSKDEDTS SIAGLDAKEV  840
KGLLPPPVSS AE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1683637912354Auxin response factor 1
4ldw_A1e-1683637912354Auxin response factor 1
4ldw_B1e-1683637912354Auxin response factor 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009769542.10.0PREDICTED: auxin response factor 2-like isoform X1
RefseqXP_016476812.10.0PREDICTED: auxin response factor 2-like
SwissprotQ94JM30.0ARFB_ARATH; Auxin response factor 2
TrEMBLA0A068VJB60.0A0A068VJB6_COFCA; Auxin response factor
STRINGPGSC0003DMT4000367650.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA26182444
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.30.0auxin response factor 2