PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc002679.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 360aa    MW: 39969.8 Da    PI: 6.0677
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc002679.1_g00002.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.52.7e-32199254156
                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                              k+r++W+peLH+rF++a++qLGGs+ AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Itr_sc002679.1_g00002.1 199 KQRRCWSPELHRRFLQALQQLGGSHAATPKQIRELMKVDGLTNDEVKSHLQKYRLH 254
                              79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.7E-29196257IPR009057Homeodomain-like
PROSITE profilePS5129414.875196256IPR017930Myb domain
SuperFamilySSF466896.42E-19197257IPR009057Homeodomain-like
TIGRFAMsTIGR015578.1E-28199254IPR006447Myb domain, plants
PfamPF002496.9E-8201252IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MLINFPEDNK TQRCRDYIQA LEEERRKIQV FRRELPLCLD LVTQAIESYK QQLSGTTTEY  60
NLNGQSECSE QTTSAAPVLE QFIPMKSAQE DDEEDYEEQS HKSDNDNDDD HHDYVDNNSE  120
KSDWLRSVQL WNQFPDPTPK EESPAPEEVK RNGSGGAFQP FKKEKSGAAA AAQPPTAASS  180
TAETGRSKKE DKESQSQRKQ RRCWSPELHR RFLQALQQLG GSHAATPKQI RELMKVDGLT  240
NDEVKSHLQK YRLHTRRPSP SNRNNSIQQQ AAPQFVVVGG IWVPPAEYAA MAAAPAPAAS  300
KEATTSNGIY APVASLPPSS AFQDPLASNR RSCGSHERGS QSNSPATSSS THTTTASPPY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-13199252255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-13199252255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-13199252154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-13199252154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-13199252154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-13199252154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-13199252255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-13199252255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-13199252255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-13199252255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-13199252255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-13199252255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in phosphate signaling in roots. {ECO:0000250|UniProtKB:Q9FX67}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019168488.10.0PREDICTED: myb family transcription factor EFM-like
SwissprotQ9FPE81e-104HHO3_ARATH; Transcription factor HHO3
TrEMBLA0A2G9GW561e-139A0A2G9GW56_9LAMI; Uncharacterized protein
TrEMBLA0A2G9I1R61e-139A0A2G9I1R6_9LAMI; Uncharacterized protein
STRINGVIT_01s0011g03110.t011e-135(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52192438
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.15e-94G2-like family protein
Publications ? help Back to Top
  1. Nagarajan VK,Satheesh V,Poling MD,Raghothama KG,Jain A
    Arabidopsis MYB-Related HHO2 Exerts a Regulatory Influence on a Subset of Root Traits and Genes Governing Phosphate Homeostasis.
    Plant Cell Physiol., 2016. 57(6): p. 1142-52
    [PMID:27016098]