PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc002656.1_g00008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family SBP
Protein Properties Length: 540aa    MW: 58937.3 Da    PI: 8.4997
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc002656.1_g00008.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.11.9e-41171246277
                              -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                      SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                              Cqv+gC++dls+ k+yh+rhkvCe+h+k+++v+v+g+eqrfCqqCsrfh l efD++krsCrrrLa+hnerrrk++
  Itr_sc002656.1_g00008.1 171 CQVHGCKKDLSSSKDYHKRHKVCEAHTKTSKVIVNGIEQRFCQQCSRFHLLAEFDDGKRSCRRRLAGHNERRRKPR 246
                              **************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.1E-35162232IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.778168245IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.72E-39169247IPR004333Transcription factor, SBP-box
PfamPF031108.0E-32171244IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 540 aa     Download sequence    Send to blast
MESWSYVSGE KGFVSEESIS VDDGIARSRN NGFMSWELKA PCGIGGTMVC SPQGDIETQG  60
MVEMGSQDLI TKSLGNNHSI SRAGDGTFFA APHNAFSGEN HSSSKLSSSV VESSSRDSSL  120
IDLKLGGIPD HRDTQITKSH KPNHPALSSA QSSTPVKRMR AGGQNSQPPF CQVHGCKKDL  180
SSSKDYHKRH KVCEAHTKTS KVIVNGIEQR FCQQCSRFHL LAEFDDGKRS CRRRLAGHNE  240
RRRKPRTALN SGRTGRLFQS YPGTSFQGTA FTTSSFVCQD ILPSSLPHPP KYEINDWYRN  300
VKVEDGVDFS PQLAIPLING QSQPRSLFPS YNPEKHFPLT RCKVSESSNS YAHDMDAPNF  360
VSHSLFNSTS VGSEVLNAFD SSSTIHGLSG MSSSGHALSL LSSHSQSSSN HSSMVPTAHH  420
LISPGTNTLF NMAHVSKKHL GASPPASTSG LSSTLNSPGI NSSDEARLEQ MLFSNSGQNF  480
AFNRVAQVSE YMNEKNQICG EDGPTINLLQ LSSRLQQVQH QRHSMQARQE SDVFSGNRIT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-291702441084squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019167070.10.0PREDICTED: squamosa promoter-binding-like protein 6 isoform X2
TrEMBLA0A240EUQ80.0A0A240EUQ8_TOBAC; Squamosa promter-binding-like protein 3
STRINGXP_009758722.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51871639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.18e-50SBP family protein