PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc002507.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family ARF
Protein Properties Length: 722aa    MW: 79953.6 Da    PI: 6.7516
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc002507.1_g00002.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.94e-23133233198
                              EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEE CS
                       B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvv 81 
                              f+k+lt sd++++g +++ +k+a+e+     +++ + +++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD +v
  Itr_sc002507.1_g00002.1 133 FCKILTASDTSTHGGFSVLRKHANEClppldMSQATPTQDLIAKDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDAFV 218
                              99****************************9555556679********************************************** PP

                              EEE-SSSEE..EEEEE- CS
                       B3  82 Fkldgrsefelvvkvfr 98 
                              F   + +++el+v+v+r
  Itr_sc002507.1_g00002.1 219 FL--RADNGELRVGVRR 233
                              **..4489999****98 PP

2Auxin_resp103.92e-34259338183
               Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                              a+ha++t++ F v+Y+Pr+  s+F++ ++k+++a+++ +svGmRf+m+fe+eds+err+sGt+vgv d+++ +W++SkWrsLk
  Itr_sc002507.1_g00002.1 259 ASHAIRTETLFVVYYKPRT--SQFIIGLNKYLEAMHHGFSVGMRFRMRFEGEDSPERRFSGTIVGVGDISS-QWKDSKWRSLK 338
                              789***************6..9**********************************************777.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.7E-39126262IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.3E-40126248IPR015300DNA-binding pseudobarrel domain
CDDcd100171.14E-19131233No hitNo description
SMARTSM010194.1E-21133235IPR003340B3 DNA binding domain
PfamPF023624.6E-21133233IPR003340B3 DNA binding domain
PROSITE profilePS5086312.083133235IPR003340B3 DNA binding domain
PfamPF065075.1E-32259338IPR010525Auxin response factor
PROSITE profilePS5174520.808607688IPR000270PB1 domain
SuperFamilySSF542772.45E-12611683No hitNo description
PfamPF023091.9E-6650687IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 722 aa     Download sequence    Send to blast
MAHVDVGIRG GVSHGVQRQS SGSGCDDLST ELWKSCAGPL VDVPKVGEKA YYFPQGHIEQ  60
LEVSTNQALT QQIPQFGLPS KILCEVVNLQ LLAEAENDEV YAQITLLPVP DQTEPISPDE  120
CKPDPPKRVV HSFCKILTAS DTSTHGGFSV LRKHANECLP PLDMSQATPT QDLIAKDLHG  180
YEWRFKHIFR GQPRRHLLTT GWSTFVTSKR LVAGDAFVFL RADNGELRVG VRRLARQQTS  240
MPPSVLSSQS MHLGVLATAS HAIRTETLFV VYYKPRTSQF IIGLNKYLEA MHHGFSVGMR  300
FRMRFEGEDS PERRFSGTIV GVGDISSQWK DSKWRSLKIQ WDEPATIPRP DRVSPWEIEP  360
FVASASADIV QPGTKTKRPR PLELPSNDDK TTSVASPFWY PGPKSAGETI SNAADQAFWQ  420
LKQKDLNGRA CNESSVTASR AHPSGMWQPG MVLSGSETIE DSTNMAPRLS ISEFSSPIPS  480
IASNGALLDQ VDGSKKSAIR IFGIEFSNAD NYRREKETPC SNTMPSNVNN ASAVCDANGV  540
GAVQKLEHLK SSREIKLVEA SLKDTLSKPS VTTPRTCTKV GTSDNSYLTV LLYRWNLLGG  600
GRIHTHLSSN KVQMEGSRFG RAVDLTTMKD YDDLLNELEE IFELKGELCP RSKWEVIYAD  660
DEGDMMLVGD DPWPEFCKMV RRIFICSSEK VKKMSSKCKL PLLSDEGEVT IVSLESELKS  720
EG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1722236113355Auxin response factor 1
4ldw_A1e-1722236113355Auxin response factor 1
4ldw_B1e-1722236113355Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1376380KRPRP
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019158375.10.0PREDICTED: auxin response factor 11-like isoform X2
SwissprotQ6YVY00.0ARFG_ORYSJ; Auxin response factor 7
TrEMBLA0A1J6ISR40.0A0A1J6ISR4_NICAT; Auxin response factor
STRINGXP_009797447.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23472450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.10.0auxin response factor 9
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]