PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc001637.1_g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 547aa    MW: 59956.1 Da    PI: 5.3206
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc001637.1_g00006.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.46.9e-33257311155
                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                              k+r+rWtpeLHe+Fveav++LGGse+AtPk +l+lmkv+gLt+++vkSHLQkYR+
  Itr_sc001637.1_g00006.1 257 KQRMRWTPELHEAFVEAVNKLGGSERATPKGVLRLMKVEGLTIYQVKSHLQKYRT 311
                              79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.186254314IPR017930Myb domain
SuperFamilySSF466891.52E-18255311IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.8E-31255313IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-25257311IPR006447Myb domain, plants
PfamPF002493.1E-10259310IPR001005SANT/Myb domain
PfamPF143791.5E-25432479IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 547 aa     Download sequence    Send to blast
MEARPALSVQ STGAGQLSNC DAFGALSSPL HVLPTNLKEI YPKFPESQQV SLGRDIIQHP  60
PAVQCPISSD SGVVGHLLSS SSGSSGFSSD LKFSSVPPHE KHPKQPSILS QSTTHSGILQ  120
AAASSHYAQE NNNSWCIDSF SDFLDYPINA PVQNSQLDYS NNADCVFTSE DLSKHSDWQE  180
WAEQLIADDD AFTHDWNNIV ADTCPTDPEA KMQYQAPNQF SNVQNQQHQA SHHPTTLSGE  240
ALIVGSASST ISGATTKQRM RWTPELHEAF VEAVNKLGGS ERATPKGVLR LMKVEGLTIY  300
QVKSHLQKYR TARYKPDSAE GSFFLQLLPN SQFIVLKLLF ISTIDDPAFK ALQKSVKALE  360
LQYDKIEKLS TTVSSLSSTS HNYAVALANL EKLVKQILTN QAGANANISP GSSEKKQTSV  420
DDLPSLDLKT GIEITEALRL QMEVQKRLHD QLEIQRNLQL RIEEQGRYLQ MMFEKQCKSM  480
PGIGLLKGLP STAENPNESD PGVPQSDHPK TDDVVNVVTL SDDSQVLCGK QVECGDEVTE  540
IPEKKCG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A9e-32257315260Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B9e-32257315260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A9e-32257315260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C9e-32257315260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D9e-32257315260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F9e-32257315260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H9e-32257315260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J9e-32257315260Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019188403.10.0PREDICTED: protein PHR1-LIKE 1-like
TrEMBLA0A1U7WMW61e-115A0A1U7WMW6_NICSY; protein PHR1-LIKE 1-like isoform X1
STRINGXP_009781296.11e-115(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27532349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G29000.34e-47G2-like family protein