PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc001618.1_g00014.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 291aa    MW: 31774.6 Da    PI: 9.8605
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc001618.1_g00014.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.65.2e-32134187255
                  G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                              pr+rWt++LH++Fv+av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Itr_sc001618.1_g00014.1 134 PRMRWTSTLHAHFVHAVQLLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 187
                              9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.58E-15131188IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.5E-28132188IPR009057Homeodomain-like
TIGRFAMsTIGR015576.4E-24134187IPR006447Myb domain, plants
PfamPF002494.5E-7135186IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0080060Biological Processintegument development
GO:0005618Cellular Componentcell wall
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MSGRGSTLPD LSLQISPPSI SSFDRSCNNI DRSSSMDSGS SGSDLSHEHN GGVSFFPPGY  60
QRSVELSLSR GFELAAAAAG LSGPLSVPVQ RNSRLEVLPQ HRHNFQPQIF GGGGRDFKRS  120
ARMIGGVKRS VRAPRMRWTS TLHAHFVHAV QLLGGHERAT PKSVLELMNV KDLTLAHVKS  180
HLQMYRTVKS TDKAPGARQS CEKAEDMIST PPSSLQTTTP RNAQRASWPP SLPEPNPLYH  240
PHLRQNDAAE MDGRDDGTGR ELCEMKGKFD RLSSSSLSSS SDTFVNLEFT L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A4e-17135189357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-17135189357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-17135189357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-17135189357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00107PBMTransfer from AT5G42630Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019174419.11e-160PREDICTED: probable transcription factor KAN4
TrEMBLA0A2G9HEY33e-71A0A2G9HEY3_9LAMI; Uncharacterized protein
STRINGXP_006473404.16e-71(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA122621822
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.23e-50G2-like family protein