PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc001475.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 404aa    MW: 45076.4 Da    PI: 7.4314
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc001475.1_g00002.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.27.6e-333589155
                  G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                             kprl+Wt++LHerFveav+qLGG++kAtPk++l+ m+++gLtl+h+kSHLQkYRl
  Itr_sc001475.1_g00002.1 35 KPRLKWTQDLHERFVEAVHQLGGADKATPKSVLKQMGIQGLTLYHLKSHLQKYRL 89
                             79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.4533292IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-303390IPR009057Homeodomain-like
SuperFamilySSF466892.87E-163490IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-233590IPR006447Myb domain, plants
PfamPF002492.1E-103788IPR001005SANT/Myb domain
PfamPF143793.6E-24140186IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MHPSTNMLMP PERHLFMQGE NGHGDSGLVL STDAKPRLKW TQDLHERFVE AVHQLGGADK  60
ATPKSVLKQM GIQGLTLYHL KSHLQKYRLS KNLHGHANSG SNKAMSSRMD AATGSDKIPE  120
ANGNHMNSAN IGPLANTNLP ISEAIQIQIE VQRRLHEQLE VQRHLQLRIE AQGKYLQAVL  180
EKAQETLGRQ DLGKMGLEAA KAQLSELVSK VSNQCLNSAF SGIKELPGFC QQQAQATQPT  240
DCSLDSCLTS SEGSLRDHEM RNSQMGLRSL NFGAHMESTD LYNETRLKQT EFRWSDDIWE  300
NRKYLSKMDE ETKNNGLSVS TGLQGGKWNG NSNYSDRRFT GTDADVKLFA QAVDRSDASK  360
PEKQKTSQEY KLPYFGPKLD LNTDDKTDVA SSCKQLDLNG FSWN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-193491158Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-193491158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-193591157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-193591157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-193591157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-193591157Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-193491158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-193491158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-193491158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-193491158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-193491158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-193491158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that may act on the GAL1 promoter (PubMed:12008900). Acts redundantly with MYR2 as a repressor of flowering and organ elongation under decreased light intensity (PubMed:21255164). Represses gibberellic acid (GA)-dependent responses and affects levels of bioactive GA (PubMed:21255164). {ECO:0000269|PubMed:21255164, ECO:0000305|PubMed:12008900}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019187464.10.0PREDICTED: myb-related protein 1-like isoform X2
SwissprotQ9FK471e-126PHLA_ARATH; Myb-related protein 1
TrEMBLA0A1J6KU240.0A0A1J6KU24_NICAT; Myb-related protein 2
STRINGXP_009619712.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29462451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18240.41e-128myb-related protein 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]