PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc001286.1_g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 366aa    MW: 42293.2 Da    PI: 7.5278
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc001286.1_g00007.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like95.25.1e-302781155
                  G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                             kpr +Wt + HerFv+av+qLGG+ kAtPk+i++lm+++ +t +h+kSHLQkYRl
  Itr_sc001286.1_g00007.1 27 KPRFKWTVQVHERFVDAVNQLGGIYKATPKNIMRLMDIEQITTDHIKSHLQKYRL 81
                             79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.76E-162582IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.8E-282684IPR009057Homeodomain-like
TIGRFAMsTIGR015573.6E-222781IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MSTPGRNETK NEKNGQEVKQ ALSGVRKPRF KWTVQVHERF VDAVNQLGGI YKATPKNIMR  60
LMDIEQITTD HIKSHLQKYR LNGSKQANTN TRKSKCFYEF FCDKSNSIST TSRTQVQHNT  120
WITYNGVSDV PEISTERQTT SQAKLEQFER AQQQVQYIER DCHGTLEQTS NNEERQYPQV  180
EEMELTTEQL DEQREMAQKD HISIMNSYPL SSPMESTNYI KPDYVGTTYS TLEIERKNFL  240
KPPYKRWLEA NKENGKFPYT SARTDDRELI IPEKKRFDAA PLKISLQMEK GSTSSGFSAD  300
ETHKRGKCYQ VYASPTSAAQ IEAQNMIAED NKTNICNFPG YKDFKAMNAS NEKSFDLNMP  360
AKEQEE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-142780255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-142780255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-142780255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-142780255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-142780255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-142780255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-142780255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-142780255Protein PHOSPHATE STARVATION RESPONSE 1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019152010.10.0PREDICTED: protein PHOSPHATE STARVATION RESPONSE 1-like isoform X6
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA120621623
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.12e-23G2-like family protein