PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc001223.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 222aa    MW: 25284 Da    PI: 7.1917
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc001223.1_g00003.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like78.39.7e-25167216151
                  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                              kprl W+p++H+rFveav++L G +kA+Pk+i+e+m+ +gLt+ehv+SHLQ
  Itr_sc001223.1_g00003.1 167 KPRLSWNPDMHQRFVEAVNKL-GFDKAVPKKIVEFMNEPGLTREHVASHLQ 216
                              79*******************.***************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521724.98E-511126IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23001.4E-814145No hitNo description
SuperFamilySSF466894.48E-15164217IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.9E-24165216IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-21167217IPR006447Myb domain, plants
PfamPF002494.9E-6169216IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MGISKRVCLF VFNEDYICQN LVSEVLQHCS YEVLHIGRAM DALTEIGKRK HGISVVLTNM  60
NRLKTKGAEI IQAIQVELNL RVCLILPGTM EFDDTRGLDC NVSAYIVNFS DTNDMKELWQ  120
SAFEKEKARK AAITTDNNEP GNDHHNRKAK ELRENQNEEC GSETKKKPRL SWNPDMHQRF  180
VEAVNKLGFD KAVPKKIVEF MNEPGLTREH VASHLQVCSV VL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A6e-15167216150Transcription factor LUX
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019160991.11e-112PREDICTED: two-component response regulator ARR2-like
TrEMBLA0A328DTD12e-89A0A328DTD1_9ASTE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA36591620
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.12e-31response regulator 2