PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc001208.1_g00008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 360aa    MW: 39264.4 Da    PI: 6.1862
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc001208.1_g00008.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like37.55.3e-124872125
                  G2-like  1 kprlrWtpeLHerFveaveqLGGse 25
                             +prlrWt +LHerFv+av+qLGG+ 
  Itr_sc001208.1_g00008.1 48 RPRLRWTADLHERFVDAVTQLGGPS 72
                             59*********************86 PP

2G2-like49.78e-161101422355
                  G2-like  23 GsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                              G+ +AtPk+i+++m+vkgLtl h+kSHLQkYRl
  Itr_sc001208.1_g00008.1 110 GEIEATPKAIMRTMGVKGLTLFHLKSHLQKYRL 142
                              7778****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.7E-284573IPR009057Homeodomain-like
TIGRFAMsTIGR015573.8E-10111143IPR006447Myb domain, plants
SuperFamilySSF466891.45E-5113144IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.7E-28114143IPR009057Homeodomain-like
PfamPF143795.0E-16186230IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MFPRLVQPRE TIGLTQEDLH LQGSNGNAQT HRVSGAGDPC LVLTSDPRPR LRWTADLHER  60
FVDAVTQLGG PSSHCLVGLH FILSGFLSDC ILITFNKAIM LILRDLDFEG EIEATPKAIM  120
RTMGVKGLTL FHLKSHLQKY RLGKQSQKDF GEASNDGLSA AYSLESPCSN NVPQNLPAPD  180
INEGYEVKEA LRVQMEVQSK LHLQVEAEKH LQIRQDAERR YLAMLEAACK ILADQIIGDV  240
VPDTEGENFQ GLGIKTALNQ PVYPSDPANI HTGPGSEEAS PRINTQCNDG STESCLTSHG  300
SPAGLPLDSS SPGGKKRILS MDSAAASFVW READTRTPGV HVVHMNSLGI NKCNEQKLSN
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ7180368e-38AJ718036.1 Nicotiana tabacum cDNA-AFLP-fragment BSTT23-3-460, cultivar Bright Yellow 2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019179367.10.0PREDICTED: protein PHR1-LIKE 3-like isoform X1
TrEMBLA0A2G3CDT51e-140A0A2G3CDT5_CAPCH; Myb family transcription factor APL
STRINGSolyc04g015290.2.11e-139(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA97642027
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.12e-56G2-like family protein