PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc001121.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family TCP
Protein Properties Length: 131aa    MW: 14703 Da    PI: 9.7693
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc001121.1_g00005.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP713.8e-221069362
                      TCP  3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikel 62
                             g+  ++s++h kv gRdRR+Rls++ca r+F L + LG+ ++++t+eWLl qa p i   
  Itr_sc001121.1_g00005.1 10 GRVEKSSDRHKKVFGRDRRIRLSLTCADRVFYLMKTLGHRTAGQTVEWLLSQAMPPINTV 69
                             566799*************************************************99865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036346.8E-211573IPR005333Transcription factor, TCP
PROSITE profilePS5136918.811569IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 131 aa     Download sequence    Send to blast
MVASNRSSSG RVEKSSDRHK KVFGRDRRIR LSLTCADRVF YLMKTLGHRT AGQTVEWLLS  60
QAMPPINTVI SGNVAQPLPV RVITPKEEPT MNPIQGLVKS ESDFLCGTEL EYSPMELAWI  120
MFQSPVVNQL V
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1567257
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08330.11e-17TCP family protein