PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc001047.1_g00016.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family TCP
Protein Properties Length: 492aa    MW: 52699.4 Da    PI: 7.2873
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc001047.1_g00016.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP129.43.6e-40862392137
                      TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsss 87 
                               g+kdrhsk+ T++g+RdRRvRls+++a++f+dLqd+LG+d++sk++eWLl++a p+i +l++++++ a+ + +e++ss++ ++++
  Itr_sc001047.1_g00016.1  86 SGGKDRHSKVLTSKGLRDRRVRLSVNTAIQFYDLQDRLGYDQPSKAVEWLLKAAAPSIADLPSLNAPFAELS-DERRSSAGLQEQE 170
                              689*************************************************************77777333.2222222222222 PP

                      TCP  88 g..................kaaksaakskksqksaasalnlak.esrakarararertrekmriknkln 137
                              +                  ++ +++ k++     a + l+l++ e r kar+rarert+ek + k+k+n
  Itr_sc001047.1_g00016.1 171 QgdiemegdhnllllskscSSTSETSKGSGGGGGAGASLSLSRsEGRIKARERARERTAEKEKEKEKEN 239
                              23577788899999*98875555555777777788888999999******************9998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.9E-3987234IPR005333Transcription factor, TCP
PROSITE profilePS5136931.36188146IPR017887Transcription factor TCP subgroup
PROSITE profilePS513709.859214231IPR017888CYC/TB1, R domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009637Biological Processresponse to blue light
GO:0009965Biological Processleaf morphogenesis
GO:0030154Biological Processcell differentiation
GO:0045962Biological Processpositive regulation of development, heterochronic
GO:1903508Biological Processpositive regulation of nucleic acid-templated transcription
GO:2000306Biological Processpositive regulation of photomorphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 492 aa     Download sequence    Send to blast
MEMEEIEAHQ GCSKFQRIGN GNGNGAKIAH NGDDPYPDEE DDGELKRGGG GAAARGLNIS  60
SSHGVGVGSL CGWPSSSRIV RVSRASGGKD RHSKVLTSKG LRDRRVRLSV NTAIQFYDLQ  120
DRLGYDQPSK AVEWLLKAAA PSIADLPSLN APFAELSDER RSSAGLQEQE QGDIEMEGDH  180
NLLLLSKSCS STSETSKGSG GGGGAGASLS LSRSEGRIKA RERARERTAE KEKEKEKENT  240
NDTSSHHHNH HHEHHLVSAR PHHHNLNPIS SSSFTELLTG TTSPSNVAAQ RAGGGGDTNT  300
NFFAKSPTPM DYFTSGLLSR PMDHHHHSSS SAFPGNIIHL TNPNNNPLAS SVSSPLFNMG  360
GGELQHFSFV SDHLPAPAGN NGNAQQQSTN NEYNLSFSIS PSSSSSGLPA GFNRGTLQSN  420
SSSPSLLPHF QRFPPLDGSS PGFFTFTAAA PNADNHHQHH QFLPRFDARL QLYYGDAHPA  480
ARPSDHKGKG KN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A1e-2293147155Putative transcription factor PCF6
5zkt_B1e-2293147155Putative transcription factor PCF6
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00063PBMTransfer from AT4G18390Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019171012.10.0PREDICTED: transcription factor TCP2
RefseqXP_019171013.10.0PREDICTED: transcription factor TCP2
TrEMBLA0A1C9HJB91e-126A0A1C9HJB9_CAMSI; Transcription factor TCP2
STRINGMigut.M00891.1.p1e-119(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24642252
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30210.25e-32TCP family protein