PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000987.1_g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family GRAS
Protein Properties Length: 179aa    MW: 19634.5 Da    PI: 7.6421
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000987.1_g00005.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS25.51.5e-08657455
                     GRAS  4 lLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar 55
                             ++ +cA+a+ +g+++ +q+lL  lselas +gd+++Rla++ ++ L ++l +
  Itr_sc000987.1_g00005.1  6 VVNHCATAIMAGNMNWVQHLLYVLSELASLTGDANHRLATHGLQVLTHHLGS 57
                             6789******************************************999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF035145.1E-6657IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MSKDKVVNHC ATAIMAGNMN WVQHLLYVLS ELASLTGDAN HRLATHGLQV LTHHLGSGSS  60
FAGVLTFCVN HYKILQGVAD DFQRHKFVVS HPKQLRELVD PPGSSVATGP AQILEFPMKS  120
NATTVDEKEG GREGKQPPPV TSIFTVDQGS SYYKCWVQMS FIFIEKCKPD PLAVDSIKI
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49492139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13840.17e-15GRAS family protein