PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000957.1_g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 326aa    MW: 35941 Da    PI: 8.0108
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000957.1_g00010.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.82.2e-3276129255
                  G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                              prlrWtp+LH +Fv+av++LGG+e+AtPk +l+lm+vkgL+++hvkSHLQ+YR+
  Itr_sc000957.1_g00010.1  76 PRLRWTPDLHLCFVQAVQRLGGQERATPKLVLQLMNVKGLSIAHVKSHLQMYRS 129
                              8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-3072130IPR009057Homeodomain-like
PROSITE profilePS5129413.4272132IPR017930Myb domain
SuperFamilySSF466896.09E-1574130IPR009057Homeodomain-like
TIGRFAMsTIGR015574.9E-2476131IPR006447Myb domain, plants
PfamPF002491.6E-977128IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MAESVVDLNM IPVDDGEEEG IIIDPKTSSS SNNHSLDDQE DEITTTSNDG NGSSNTAAGS  60
GGTGGGVRQY VRSKVPRLRW TPDLHLCFVQ AVQRLGGQER ATPKLVLQLM NVKGLSIAHV  120
KSHLQMYRSK KVDDHGQVIN ERAGYHTGNA NNLLQNLWQL PMFDRRIRSN FRYMNNSWSS  180
SNANWMSARN DSIINGGFGM NKNTIFTGPE CKRGHEALRE ANNNGKPTQL QPGEESLIMP  240
SFINGVSNSP DIKWTSFSPA NAMKRNGAGG EKGVDLNLTL SMNLKREREQ DEGNIRHCKR  300
RCLDGGEEVD SSLSLSLSSS RSKFAF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-1977131357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-1977131357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-1977131357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-1977131357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019178252.11e-165PREDICTED: putative two-component response regulator ARR19
STRINGVIT_06s0004g07000.t012e-54(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43822141
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.13e-39G2-like family protein