PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000868.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 311aa    MW: 35423.8 Da    PI: 6.7888
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000868.1_g00002.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like94.39.5e-302073255
                  G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                             prl+WtpeLHe+Fv+ ve+LGG  kAtPk+i+++m+vkgL ++hvkSHLQ+YR 
  Itr_sc000868.1_g00002.1 20 PRLQWTPELHEHFVDTVESLGGRYKATPKRIVQMMGVKGLKISHVKSHLQMYRN 73
                             8****************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.4141676IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.8E-271777IPR009057Homeodomain-like
SuperFamilySSF466892.15E-132076IPR009057Homeodomain-like
TIGRFAMsTIGR015576.0E-212073IPR006447Myb domain, plants
PfamPF002491.7E-72172IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MMRSNGQRNG VRQYKKSALP RLQWTPELHE HFVDTVESLG GRYKATPKRI VQMMGVKGLK  60
ISHVKSHLQM YRNMRERTTF DVFVPAESCN FRDGRLHSST WAPQGHTFER LLRQSFDESD  120
EEKKLGCYFS GNNERNESNP IGHHLFYQES QGSLNCEMTT TKAEEDGGGP SDETFEQIPQ  180
SAYNNNEDHS RQVSPVKDDR NSQSGAASTD TVDLRHLHST KDSEINLDLS ISCLYCYFHD  240
LPLIIYVGVL IGTSGATRLQ GTYCILSFIA AIFIFIFIFI FFSSRIPGYC SDLLLAHQDL  300
IFLLHSPQHS L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-182177460Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-182177460Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-182177460Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-182177460Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-182177460Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-182177460Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-182177460Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-182177460Protein PHOSPHATE STARVATION RESPONSE 1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019193067.11e-158PREDICTED: putative two-component response regulator ARR20
TrEMBLA0A484MY147e-64A0A484MY14_9ASTE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA94591325
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14600.12e-25G2-like family protein