PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000793.1_g00029.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 448aa    MW: 48305.6 Da    PI: 9.2953
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000793.1_g00029.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.84.4e-32297350255
                  G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                              pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Itr_sc000793.1_g00029.1 297 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 350
                              9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.69E-15294350IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-28295350IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-23297350IPR006447Myb domain, plants
PfamPF002498.3E-7298349IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 448 aa     Download sequence    Send to blast
MPLEGVFIEP SRSNPLPDLS LHISPPNNNT ISSSPSSCIN ELVAAAAGFD LPTTTNHHRT  60
NSTSAASSQQ VFPELSLANP TTTAAEAENR FLRTGGREQP PQTYPPPYHL GTHTFQNNGS  120
NNNNSSSCSQ MSNINHGVSL LDVSDGLRPI KGIPVYQNRS FPFLPTMDHH HHGSRENKDP  180
SKMCFYPMPP PSTSISHSPS PFFNPVIDHL SLLNNPSPSS SSSAAAAAAY RRFNGLSSAY  240
QLPHNQYGGV GIGAAAAANH HHHHHHHPHH DAPPSHGMMM RSRFLPKLPA KRSMRAPRMR  300
WTSTLHARFV HAVELLGGHE RATPKSVLEL MDVKDLTLAH VKSHLQMYRT VKTTDKPAAS  360
SGQSDGSGEE DLTVLGSTAG GGGGSSGGGI RLMDQRGAAD GSSSQLEQDF PNSTTTTLWS  420
NSSRKMGKSL ANKTRTYNQQ QQQLAGDF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-16298352458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-16298352458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-16298352357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-16298352357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-16298352357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-16298352357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-16298352458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-16298352458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-16298352458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-16298352458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-16298352458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-16298352458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2209680.0AB220968.1 Ipomoea nil FE mRNA for KANADI-like transcription factor FEATHERED, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019172029.10.0PREDICTED: transcription repressor KAN1 isoform X1
RefseqXP_019172030.10.0PREDICTED: transcription repressor KAN1 isoform X1
RefseqXP_019172031.10.0PREDICTED: transcription repressor KAN1 isoform X2
TrEMBLQ2PF880.0Q2PF88_IPONI; KANADI-like transcription factor FEATHERED
STRINGcassava4.1_008805m1e-124(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24682355
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.12e-50G2-like family protein