PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000771.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family G2-like
Protein Properties Length: 347aa    MW: 38779.7 Da    PI: 7.8761
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000771.1_g00003.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.74.7e-322074155
                  G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                             kprl+WtpeLH+rFv+a++qLGG++kAtPk+++++m+++gLtl+h+kSHLQk+Rl
  Itr_sc000771.1_g00003.1 20 KPRLKWTPELHQRFVDAIAQLGGADKATPKSLMRAMNIHGLTLYHLKSHLQKFRL 74
                             79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.3761777IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.1E-301776IPR009057Homeodomain-like
SuperFamilySSF466891.4E-151975IPR009057Homeodomain-like
TIGRFAMsTIGR015572.8E-222075IPR006447Myb domain, plants
PfamPF002495.3E-72272IPR001005SANT/Myb domain
PfamPF143797.2E-23115162IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MALQKSNNKD PRLVLSRDAK PRLKWTPELH QRFVDAIAQL GGADKATPKS LMRAMNIHGL  60
TLYHLKSHLQ KFRLGKSQQL QPYQDNEQGD HRECLSHLPA ADRCDEAERQ MNENMQIARA  120
LQMQMEVQRK LHEQIEVQRH LQLRIEAQGK YLQSVMKKAQ ETLAGYGSCT GVELAAKTEL  180
SKLVSMVEMG VCLQSSSMSV LTEKEGSVTK ETENKHLRTA TGCSLESSSS PSSSESSGRM  240
EHSRAKQRAE DDSHTIELSL MEMHSTHHNA SNDEARSGRK RSQSSTSMSD NTACVEKPSD  300
KIFKASSTYD EKKYGFLENL DLNAKCLSDF DTGPKVIDLN SNGVGTI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-171976158Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-171976158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-172076157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-172076157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-172076157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-172076157Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-171976158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-171976158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-171976158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-171976158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-171976158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-171976158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019164978.10.0PREDICTED: myb family transcription factor PHL8-like isoform X1
TrEMBLA0A1S3XQY01e-106A0A1S3XQY0_TOBAC; uncharacterized protein LOC107767787 isoform X2
STRINGXP_009777109.11e-107(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA60361932
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69580.12e-65G2-like family protein