PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000759.1_g00012.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family GRAS
Protein Properties Length: 539aa    MW: 60752.1 Da    PI: 5.8032
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000759.1_g00012.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS2608.2e-801665371374
                     GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl... 83 
                              lv+lLl++ e vs ++ +la+ +++r   +as +g+p+qRla+ f+eAL +r+ r+ ++ ++ ++ ++ ++ ++s +l+   +   
  Itr_sc000759.1_g00012.1 166 LVHLLLAAGEEVSRRQYHLATGFISRCLWIASDSGTPVQRLAFQFAEALTERIERE-TGRFRGVSEERLARCRESMALSCNPAlla 250
                              689****************************************************4.44444444444443344444443333334 PP

                     GRAS  84 fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp..slRiTgvgspesgskeeleetgerLak 167
                               ++  P+ ++ +++  qaI e v++++++H +D++i  G+QW  L+qaLa++ +++p  ++R+T++g     ++e++ee g+rL++
  Itr_sc000759.1_g00012.1 251 SHQGLPFGQVIQFAGIQAIIERVKNARKIHLVDINIRSGIQWTILMQALAEQHGSSPieRIRLTAIGV---AEREKMEECGKRLQS 333
                              67889************************************************8887779********...579************ PP

                     GRAS 168 fAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesF 253
                              fA++l++pf f+ +  ++l+d++ +  +v+++E +aV  +  l ++  ++ +l++    +++ +++l+P v+vv+e ea+hns+sF
  Itr_sc000759.1_g00012.1 334 FANSLNLPFYFDSVFLSDLKDFKEDLVQVENEEIVAVLASTVLRTMIVRPDCLDN----LMRGIRGLRPAVMVVAEVEANHNSPSF 415
                              **********************************************977666666....*************************** PP

                     GRAS 254 lerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqakl 339
                               +rf+eal ++ a fd+l   l  ++  r+++E   +g+ i+n+va+eg+er++++ + e Wr+ + ++ +++++ls++ + qa+l
  Itr_sc000759.1_g00012.1 416 INRFVEALFFFGAYFDCLGDCLDGDDPCRRTLEGLHFGEGIRNMVAAEGEERFAKNVKIEVWRAYFARFAMEEMQLSDSSVYQANL 501
                              ************************************************************************************** PP

                     GRAS 340 llrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                              + +k++ ++  +++ + + l++gWk+ p+ sv++W+
  Itr_sc000759.1_g00012.1 502 VGEKFGnGNSCTIDRSGKGLIFGWKGTPMHSVTCWK 537
                              ******888899***********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.088140516IPR005202Transcription factor GRAS
PfamPF035142.8E-77166537IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 539 aa     Download sequence    Send to blast
MPGVSFPSAP FNHDLHLHRK GSVNDELRCS KDDNNDWFEM EGFDDFNSLF AGDKRIEHLI  60
IEDQNQILSP NPQVSELKPQ QTPFSSACFE ILKCYGRFFK DRSSLASKTD RLDVSGKLSV  120
VEILRLAGER YIQFFTQKAD GFSAFFHPYA SALSGISVDD TRDVELVHLL LAAGEEVSRR  180
QYHLATGFIS RCLWIASDSG TPVQRLAFQF AEALTERIER ETGRFRGVSE ERLARCRESM  240
ALSCNPALLA SHQGLPFGQV IQFAGIQAII ERVKNARKIH LVDINIRSGI QWTILMQALA  300
EQHGSSPIER IRLTAIGVAE REKMEECGKR LQSFANSLNL PFYFDSVFLS DLKDFKEDLV  360
QVENEEIVAV LASTVLRTMI VRPDCLDNLM RGIRGLRPAV MVVAEVEANH NSPSFINRFV  420
EALFFFGAYF DCLGDCLDGD DPCRRTLEGL HFGEGIRNMV AAEGEERFAK NVKIEVWRAY  480
FARFAMEEMQ LSDSSVYQAN LVGEKFGNGN SCTIDRSGKG LIFGWKGTPM HSVTCWKFS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-3319653733375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019188248.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLA0A1S4A0M90.0A0A1S4A0M9_TOBAC; DELLA protein RGL1-like
STRINGXP_009628660.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46941842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.14e-49RGA-like 1